Anti-Cathepsin F antibody (ab200650)
Key features and details
- Rabbit polyclonal to Cathepsin F
- Suitable for: WB
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-Cathepsin F antibody
See all Cathepsin F primary antibodies -
Description
Rabbit polyclonal to Cathepsin F -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Synthetic peptide corresponding to Human Cathepsin F aa 261-306 (internal sequence).
Sequence:MKQAKSVGDLAPPEWDWRSKGAVTKVKDQGMCGSCWAFSVTGNVEG
Database link: Q9UBX1 -
Positive control
- HEK293T, Raw264.7 and H9C2 whole cell lysates.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.09% Sodium azide
Constituent: 99% PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
Purity of ab200650 is > 95% (by SDS-PAGE). -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab200650 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use at an assay dependent concentration. Predicted molecular weight: 53 kDa. |
Target
-
Function
Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis. -
Tissue specificity
High expression levels in heart, skeletal muscle, brain, testis and ovary; moderate levels in prostate, placenta, liver and colon; and no detectable expression in peripheral leukocytes and thymus. -
Sequence similarities
Belongs to the peptidase C1 family. -
Cellular localization
Lysosome. - Information by UniProt
-
Database links
- Entrez Gene: 8722 Human
- Entrez Gene: 56464 Mouse
- Entrez Gene: 361704 Rat
- Omim: 603539 Human
- SwissProt: Q9UBX1 Human
- SwissProt: Q9R013 Mouse
- Unigene: 11590 Human
- Unigene: 29561 Mouse
-
Alternative names
- AI481912 antibody
- CATF_HUMAN antibody
- Cathepsin F antibody
see all
Images
-
Western blot - Anti-Cathepsin F antibody (ab200650)All lanes : Anti-Cathepsin F antibody (ab200650)
Lane 1 : HEK293T whole cell lysate
Lane 2 : Raw264.7 whole cell lysate
Lane 3 : H9C2 whole cell lysate
Predicted band size: 53 kDa
Datasheets and documents
References (1)
ab200650 has been referenced in 1 publication.
- Birket MJ et al. A Human Stem Cell Model of Fabry Disease Implicates LIMP-2 Accumulation in Cardiomyocyte Pathology. Stem Cell Reports 13:380-393 (2019). PubMed: 31378672
