Anti-Cathepsin F antibody (ab200650)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Cathepsin F antibody
See all Cathepsin F primary antibodies -
Description
Rabbit polyclonal to Cathepsin F -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Synthetic peptide corresponding to Human Cathepsin F aa 261-306 (internal sequence).
Sequence:MKQAKSVGDLAPPEWDWRSKGAVTKVKDQGMCGSCWAFSVTGNVEG
Database link: Q9UBX1 -
Positive control
- HEK293T, Raw264.7 and H9C2 whole cell lysates.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.09% Sodium azide
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Purity of ab200650 is > 95% (by SDS-PAGE). -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab200650 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use at an assay dependent concentration. Predicted molecular weight: 53 kDa. |
Target
-
Function
Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis. -
Tissue specificity
High expression levels in heart, skeletal muscle, brain, testis and ovary; moderate levels in prostate, placenta, liver and colon; and no detectable expression in peripheral leukocytes and thymus. -
Sequence similarities
Belongs to the peptidase C1 family. -
Cellular localization
Lysosome. - Information by UniProt
-
Database links
- Entrez Gene: 8722 Human
- Entrez Gene: 56464 Mouse
- Entrez Gene: 361704 Rat
- Omim: 603539 Human
- SwissProt: Q9UBX1 Human
- SwissProt: Q9R013 Mouse
- Unigene: 11590 Human
- Unigene: 29561 Mouse
-
Alternative names
- AI481912 antibody
- CATF_HUMAN antibody
- Cathepsin F antibody
see all
Images
Protocols
Datasheets and documents
References
ab200650 has not yet been referenced specifically in any publications.