Overview

  • Product name

  • Description

    Rabbit polyclonal to Cathepsin G
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human Cathepsin G aa 71-120. The exact sequence is proprietary. (Immunogen corresponds to a region around amino acid Arg116).
    Sequence:

    NVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRR


    Database link: P08311

  • Positive control

    • HeLa whole cell lysate; Human spleen tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab192793 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 10 µg/ml.
WB 1/500 - 1/1000. Predicted molecular weight: 29 kDa.

Target

  • Function

    Serine protease with trypsin- and chymotrypsin-like specificity. Cleaves complement C3. Has antibacterial activity against the Gram-negative bacterium P.aeruginosa, antibacterial activity is inhibited by LPS from P.aeruginosa, Z-Gly-Leu-Phe-CH2Cl and phenylmethylsulfonyl fluoride.
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 1 peptidase S1 domain.
  • Cellular localization

    Cell surface.
  • Information by UniProt
  • Database links

  • Alternative names

    • CATG antibody
    • CATG_HUMAN antibody
    • Cathepsin G antibody
    • Cathepsin G precursor antibody
    • CathepsinG antibody
    • CG antibody
    • Ctsg antibody
    • CTSG protein antibody
    • MGC23078 antibody
    see all

Images

  • Immunohistochemical analysis of formalin fixed, paraffin embedded Human spleen cells labeling Cathepsin G with ab192793 at 10 µg/ml.

  • Anti-Cathepsin G antibody (ab192793) at 1/500 dilution + HeLa whole cell lysate

    Predicted band size: 29 kDa

References

ab192793 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Liver)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: pH 6.0 Citrate
Permeabilization
No
Specification
Liver
Blocking step
PB ab64226 as blocking agent for 10 minute(s) · Concentration: 1% · Temperature: RT°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Jan 23 2018

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (Testis)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: pH 6.0 Citrate
Permeabilization
No
Specification
Testis
Blocking step
PB ab64226 as blocking agent for 10 minute(s) · Concentration: 1% · Temperature: RT°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Jan 17 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up