Overview

  • Product name

  • Description

    Rabbit polyclonal to Cathepsin G
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Rat Cathepsin G aa 51-250. (Expressed in E.coli).
    Sequence:

    GFLVREDFVLTAGHCFGSSINVTLGAHNIRRQEGTQQHITVLRAIRHPDY NPPPVIQNDIMLLQLRSRARRSRAVKPVALPQATKRVQPGALCTVAGWGL VSQRRGTNVLQEVKLRVQTDQTCANRFQFYNSQTQICVGNPRERKSAFKG DSGGPLVCNNVAQGIVSYGSSSGNPPAVFTRIQSFMPWIKRTMRRLSSRY


    Database link: G3V9Q7

  • Positive control

    • WB: Recombinant rat Cathepsin G protein; Rat serum; Rat heart lysate; MCF7 cell lysate. IHC-P: Rat spinal cord tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231149 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 29 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Serine protease with trypsin- and chymotrypsin-like specificity. Cleaves complement C3. Has antibacterial activity against the Gram-negative bacterium P.aeruginosa, antibacterial activity is inhibited by LPS from P.aeruginosa, Z-Gly-Leu-Phe-CH2Cl and phenylmethylsulfonyl fluoride.
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 1 peptidase S1 domain.
  • Cellular localization

    Cell surface.
  • Information by UniProt
  • Database links

  • Alternative names

    • CATG antibody
    • CATG_HUMAN antibody
    • Cathepsin G antibody
    • Cathepsin G precursor antibody
    • CathepsinG antibody
    • CG antibody
    • Ctsg antibody
    • CTSG protein antibody
    • MGC23078 antibody
    see all

Images

  • Anti-Cathepsin G antibody (ab231149) at 3 µg/ml + Recombinant rat Cathepsin G protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 29 kDa

  • All lanes : Anti-Cathepsin G antibody (ab231149) at 3 µg/ml

    Lane 1 : Rat serum
    Lane 2 : Rat heart lysate
    Lane 3 : MCF7 (human breast adenocarcinoma cell line) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 29 kDa

  • Paraffin-embedded rat spinal cord tissue stained for Cathepsin G with ab231149 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat spinal cord tissue stained for Cathepsin G with ab231149 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab231149 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231149.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up