Anti-Cathepsin K antibody [3F9] (ab37259)
Key features and details
- Mouse monoclonal [3F9] to Cathepsin K
- Suitable for: WB, IHC-P, Flow Cyt
- Reacts with: Mouse, Human
- Isotype: IgG2b
Overview
-
Product name
Anti-Cathepsin K antibody [3F9]
See all Cathepsin K primary antibodies -
Description
Mouse monoclonal [3F9] to Cathepsin K -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-P, Flow Cytmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant fusion protein, corresponding to amino acids 115-329 of Human Cathepsin K. The protein contains at the N-terninal end a His tag (6x) and 6 additional amino acid residues (MRGSHHHHHHGS).
-
Epitope
The monoclonal antibody ab37259 (clone 3F9) reacts with an epitope located between aa 115-329: APDSVDYRKKGYVTPNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGC GGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRA VARVGPVSVAIDASLTSFQFSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGE NWGNKGYILMARNKNNACGIANLASFPKM -
General notes
This product was changed from ascites to tissue culture supernatant on 22nd December 2017. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. -
Storage buffer
Constituents: 0.58% Sodium chloride, 0.134% PBS -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
3F9 -
Isotype
IgG2b -
Research areas
Associated products
-
Assay kits
-
Compatible Secondaries
-
Conjugation kits
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab37259 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Use a concentration of 1 µg/ml. Detects a band of approximately 37, 40 kDa (predicted molecular weight: 37 kDa).
|
|
IHC-P |
Use at an assay dependent concentration.
|
|
Flow Cyt |
Use 1µg for 106 cells.
ab170192 - Mouse monoclonal IgG2b, is suitable for use as an isotype control with this antibody.
|
Notes |
---|
WB
Use a concentration of 1 µg/ml. Detects a band of approximately 37, 40 kDa (predicted molecular weight: 37 kDa). |
IHC-P
Use at an assay dependent concentration. |
Flow Cyt
Use 1µg for 106 cells. ab170192 - Mouse monoclonal IgG2b, is suitable for use as an isotype control with this antibody.
|
Target
-
Function
Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation. -
Tissue specificity
Predominantly expressed in osteclasts (bones). -
Involvement in disease
Defects in CTSK are the cause of pycnodysostosis (PKND) [MIM:265800]. PKND is an autosomal recessive osteochondrodysplasia characterized by osteosclerosis and short stature. -
Sequence similarities
Belongs to the peptidase C1 family. -
Cellular localization
Lysosome. - Information by UniProt
-
Database links
- Entrez Gene: 1513 Human
- Entrez Gene: 13038 Mouse
- Omim: 601105 Human
- SwissProt: P43235 Human
- SwissProt: P55097 Mouse
- Unigene: 632466 Human
- Unigene: 272085 Mouse
-
Alternative names
- Cathepsin K antibody
- Cathepsin O antibody
- Cathepsin O1 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cathepsin K antibody [3F9] (ab37259)Bone from mouse foot (bone marrow with osteoclasts (positive). IHC-P image was obtained after deparaffinization, antigen retrieval with 0.1 M EDTA (6-8 min, 72 C), drying of slide before staining (10 min, 62 C), and subsequent staining with primary antibody (1/100) in 1% horse serum (1 h, 37 C).
-
Anti-Cathepsin K antibody [3F9] (ab37259) at 1 µg/ml + Human bone tumor tissue lysate - total protein (ab29359) at 10 µg
Secondary
Goat polyclonal Secondary Antibody to Mouse IgG - H&L (HRP), pre-adsorbed at 1/3000 dilution
Developed using the ECL technique.
Performed under reducing conditions.
Predicted band size: 37 kDa
Observed band size: 37 + 40 kDa why is the actual band size different from the predicted?
Additional bands at: 26 kDa (possible cleavage fragment)
Exposure time: 1 minute
Cathepsin K contains a potential glycosylation site (SwissProt) which may explain its migration at a higher molecular weight than predicted, seen at 40 kDa. The band observed at 25 kDa could potentially be a cleaved form of Cathepsin K due to the presence of both a 15 amino acid signal prptide and a 99 amino acid propeptide. Cathepsin K in its mature form has an expected molecular weight of 25 kDa. -
Overlay histogram showing U20S cells stained with ab37259 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab37259, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG2b [PLPV219] (ab91366, 2µg/1x106 cells ) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in U20S cells fixed with 4% paraformaldehyde (10 min)/permeabilized in 0.1% PBS-Tween used under the same conditions.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (21)
ab37259 has been referenced in 21 publications.
- Jia X et al. Overexpression of miRNA-22-3p attenuates osteoporosis by targeting MAPK14. Exp Ther Med 22:692 (2021). PubMed: 33986857
- Gruber-Moesenbacher U et al. Myopericytoma arising from myopericytosis-a hitherto unrecognized entity within the lung. Virchows Arch 478:841-849 (2021). PubMed: 33244708
- Zhou Y et al. Single-cell RNA landscape of intratumoral heterogeneity and immunosuppressive microenvironment in advanced osteosarcoma. Nat Commun 11:6322 (2020). PubMed: 33303760
- Yang B et al. Xp11 translocation renal cell carcinoma and clear cell renal cell carcinoma with TFE3 strong positive immunostaining: morphology, immunohistochemistry, and FISH analysis. Mod Pathol 32:1521-1535 (2019). PubMed: 31175325
- Meng J et al. Stachydrine prevents LPS-induced bone loss by inhibiting osteoclastogenesis via NF-?B and Akt signalling. J Cell Mol Med 23:6730-6743 (2019). PubMed: 31328430