For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    cathepsin-k-antibody-3f9-ab37259.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cardiovascular Angiogenesis Adhesion / ECM Extracellular Matrix
Share by email

Anti-Cathepsin K antibody [3F9] (ab37259)

  • Datasheet
  • SDS
Submit a review Q&A (2)References (21)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cathepsin K antibody [3F9] (ab37259)
  • Western blot - Anti-Cathepsin K antibody [3F9] (ab37259)
  • Flow Cytometry - Anti-Cathepsin K antibody [3F9] (ab37259)

Key features and details

  • Mouse monoclonal [3F9] to Cathepsin K
  • Suitable for: WB, IHC-P, Flow Cyt
  • Reacts with: Mouse, Human
  • Isotype: IgG2b

You may also be interested in

Primary
Product image
Anti-GAB1 antibody [EPR375] (ab133486)
Primary
Product image
Anti-ATRX antibody [CL0537] (ab188027)
Primary
Product image
Anti-IDH1 antibody [IDH1/1152] - BSA and Azide free (ab212470)

View more associated products

Overview

  • Product name

    Anti-Cathepsin K antibody [3F9]
    See all Cathepsin K primary antibodies
  • Description

    Mouse monoclonal [3F9] to Cathepsin K
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, Flow Cytmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fusion protein, corresponding to amino acids 115-329 of Human Cathepsin K. The protein contains at the N-terninal end a His tag (6x) and 6 additional amino acid residues (MRGSHHHHHHGS).

  • Epitope

    The monoclonal antibody ab37259 (clone 3F9) reacts with an epitope located between aa 115-329: APDSVDYRKKGYVTPNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGC GGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRA VARVGPVSVAIDASLTSFQFSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGE NWGNKGYILMARNKNNACGIANLASFPKM
  • General notes

    This product was changed from ascites to tissue culture supernatant on 22nd December 2017. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituents: 0.58% Sodium chloride, 0.134% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    3F9
  • Isotype

    IgG2b
  • Research areas

    • Cardiovascular
    • Angiogenesis
    • Adhesion / ECM
    • Extracellular Matrix
    • Neuroscience
    • Cell Adhesion Proteins
    • Proteases
    • Signal Transduction
    • Cytoskeleton / ECM
    • Extracellular Matrix
    • ECM Enzymes
    • Other Enzymes
    • Cancer
    • Invasion/microenvironment
    • ECM
    • Extracellular matrix
    • Other
    • Cell Biology
    • Proteolysis / Ubiquitin
    • Proteolytic enzymes
    • Cysteine protease
    • Cathepsins
    • Cardiovascular
    • Atherosclerosis
    • Thrombosis
    • Other

Associated products

  • Assay kits

    • Cathepsin K Inhibitor Assay Kit (Fluorometric) (ab185439)
    • Cathepsin K Activity Assay Kit (Fluorometric) (ab65303)
  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
    • Goat Anti-Mouse IgG H&L (DyLight® 488) preadsorbed (ab96879)
  • Conjugation kits

    • PE / R-Phycoerythrin Conjugation Kit - Lightning-Link® (ab102918)
    • APC Conjugation Kit - Lightning-Link® (ab201807)
  • Isotype control

    • Mouse IgG2b, kappa monoclonal [7E10G10] - Isotype Control (ab170192)
  • Recombinant Protein

    • Recombinant human Cathepsin K protein (Active) (ab157067)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab37259 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB
Use a concentration of 1 µg/ml. Detects a band of approximately 37, 40 kDa (predicted molecular weight: 37 kDa).
IHC-P
Use at an assay dependent concentration.
Flow Cyt
Use 1µg for 106 cells.

ab170192 - Mouse monoclonal IgG2b, is suitable for use as an isotype control with this antibody.

 

Notes
WB
Use a concentration of 1 µg/ml. Detects a band of approximately 37, 40 kDa (predicted molecular weight: 37 kDa).
IHC-P
Use at an assay dependent concentration.
Flow Cyt
Use 1µg for 106 cells.

ab170192 - Mouse monoclonal IgG2b, is suitable for use as an isotype control with this antibody.

 

Target

  • Function

    Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation.
  • Tissue specificity

    Predominantly expressed in osteclasts (bones).
  • Involvement in disease

    Defects in CTSK are the cause of pycnodysostosis (PKND) [MIM:265800]. PKND is an autosomal recessive osteochondrodysplasia characterized by osteosclerosis and short stature.
  • Sequence similarities

    Belongs to the peptidase C1 family.
  • Cellular localization

    Lysosome.
  • Target information above from: UniProt accession P43235 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 1513 Human
    • Entrez Gene: 13038 Mouse
    • Omim: 601105 Human
    • SwissProt: P43235 Human
    • SwissProt: P55097 Mouse
    • Unigene: 632466 Human
    • Unigene: 272085 Mouse
    • Alternative names

      • Cathepsin K antibody
      • Cathepsin O antibody
      • Cathepsin O1 antibody
      • Cathepsin O2 antibody
      • Cathepsin X antibody
      • CATK_HUMAN antibody
      • CTS02 antibody
      • Ctsk antibody
      • CTSO antibody
      • CTSO1 antibody
      • CTSO2 antibody
      • MGC23107 antibody
      • PKND antibody
      • PYCD antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cathepsin K antibody [3F9] (ab37259)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cathepsin K antibody [3F9] (ab37259)
      Bone from mouse foot (bone marrow with osteoclasts (positive). IHC-P image was obtained after deparaffinization, antigen retrieval with 0.1 M EDTA (6-8 min, 72 C), drying of slide before staining (10 min, 62 C), and subsequent staining with primary antibody (1/100) in 1% horse serum (1 h, 37 C).
    • Western blot - Anti-Cathepsin K antibody [3F9] (ab37259)
      Western blot - Anti-Cathepsin K antibody [3F9] (ab37259)
      Anti-Cathepsin K antibody [3F9] (ab37259) at 1 µg/ml + Human bone tumor tissue lysate - total protein (ab29359) at 10 µg

      Secondary
      Goat polyclonal Secondary Antibody to Mouse IgG - H&L (HRP), pre-adsorbed at 1/3000 dilution

      Developed using the ECL technique.

      Performed under reducing conditions.

      Predicted band size: 37 kDa
      Observed band size: 37 + 40 kDa why is the actual band size different from the predicted?
      Additional bands at: 26 kDa (possible cleavage fragment)


      Exposure time: 1 minute


      Cathepsin K contains a potential glycosylation site (SwissProt) which may explain its migration at a higher molecular weight than predicted, seen at 40 kDa. The band observed at 25 kDa could potentially be a cleaved form of Cathepsin K due to the presence of both a 15 amino acid signal prptide and a 99 amino acid propeptide. Cathepsin K in its mature form has an expected molecular weight of 25 kDa.
    • Flow Cytometry - Anti-Cathepsin K antibody [3F9] (ab37259)
      Flow Cytometry - Anti-Cathepsin K antibody [3F9] (ab37259)
      Overlay histogram showing U20S cells stained with ab37259 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab37259, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG2b [PLPV219] (ab91366, 2µg/1x106 cells ) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in U20S cells fixed with 4% paraformaldehyde (10 min)/permeabilized in 0.1% PBS-Tween used under the same conditions.

    Protocols

    • Flow cytometry protocols
    • Immunohistochemistry protocols
    • Western blot protocols

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (21)

    Publishing research using ab37259? Please let us know so that we can cite the reference in this datasheet.

    ab37259 has been referenced in 21 publications.

    • Jia X  et al. Overexpression of miRNA-22-3p attenuates osteoporosis by targeting MAPK14. Exp Ther Med 22:692 (2021). PubMed: 33986857
    • Gruber-Moesenbacher U  et al. Myopericytoma arising from myopericytosis-a hitherto unrecognized entity within the lung. Virchows Arch 478:841-849 (2021). PubMed: 33244708
    • Zhou Y  et al. Single-cell RNA landscape of intratumoral heterogeneity and immunosuppressive microenvironment in advanced osteosarcoma. Nat Commun 11:6322 (2020). PubMed: 33303760
    • Yang B  et al. Xp11 translocation renal cell carcinoma and clear cell renal cell carcinoma with TFE3 strong positive immunostaining: morphology, immunohistochemistry, and FISH analysis. Mod Pathol 32:1521-1535 (2019). PubMed: 31175325
    • Meng J  et al. Stachydrine prevents LPS-induced bone loss by inhibiting osteoclastogenesis via NF-?B and Akt signalling. J Cell Mol Med 23:6730-6743 (2019). PubMed: 31328430
    View all Publications for this product

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-2 of 2 Abreviews or Q&A

    Question

    Buongiorno,

    vi scrivo in italiano e spero riusciate a tradurre.

    Sto cercando di mettere a punto l’Ab Cathepsin K (ab37259) con il sistema di rivelazione Dako FLEX+. Dal data sheet si evince che il seguente metodo:

    1) antigen retrieval : EDTA 6-8’ a 72°C
    2) passaggio successivo: asciugare le sezioni 10’ a 62°C
    3) incubazione Ab primario ( diluito 1:100 in 1% di siero normale di cavallo ) per 1h a 37°C


    domande:

    1.Perchè l’antigen retrieval solo a 72°C anziché i canonici 98°C?
    2.Perché asciugare le sezioni, dato che è una certezza da sempre non dover mai asciugare le sezioni?
    3.Perché diluire l’Ab primario in horse serum 1% e perché incubarlo a 37°C? E’ forse molto debole? Infatti la diluizione consigliata prevede una concentrazione a 10µg/ml… abbastanza alta


    Resto in attesa di chiarimenti

    Grazie per la collaborazione

    Read More

    Abcam community

    Verified customer

    Asked on Jun 27 2012

    Answer

    Grazie per la sua domanda. Vi rispondo in Inglese - se ha bisogno di una traduzione, mi faccia sapere per favore. Grazie!
    Thank you for your inquiry.
    The protocol on the datasheet is this protocol is from a customer who tested our antibody and provided his results and photo. The information about the drying is from him too. Unfortunately we do not know more.
    As the tissue he used was bone as well, I would suspect that on bone tissue you can have special protocols (albeit decalcification is before fixation normally).
    In any case, I can recommend you to follow your protocol which is established in your laboratory. I would recommend a normal heat induced antigen retrieval with boiling and only if your tissue is very sensitive, to do antigen retrieval overnight at 70°C. I would also recommend to test different antigen retrieval solutions at different pHs, as we recommend for all our antibodies.
    I do also absolutely agree with you, that after rehydratation the sections should never dry out again, as this will impair the staining strongly.
    The antibody incubation can be done at 37°C, however we recommend to incubate the antibody either 1 to 2 hours at room temperature or overnight at 4°C. This will be absolutely sufficient.
    So in summary, I can recommend you to perform the immunostaining with this antibody as you would do normally. We do guarantee this antibody to work also with a classical IHC protocol.
    I hope this information is helpful. Please do not hesitate to contact us again should you have any further question.

    Read More

    Abcam Scientific Support

    Answered on Jun 28 2012

    Question

    Dear Colleagues

    We have a customer that asks us, referred to ab37259, why you recommend the following steps: “Bone from mouse foot (bone marrow with osteoclasts (positive). IHC-P image was obtained after deparaffinization, antigen retrieval with 0.1 M EDTA (6-8 min, 72 C), drying of slide before staining (10 min, 62 C), and subsequent staining with primary antibody (1/100) in 1% horse serum (1 h, 37 C)”

    Thanks a lot for your precious collaboration

    With my best regards

    Read More

    Abcam community

    Verified customer

    Asked on Jun 18 2012

    Answer

    Thank you for contacting us and your interest in our products.

    I am sorry if the product datasheet has been misleading for your customer. The details provided with the image are to illustrate how this particular IHC staining experiment was performed. They are not intended as a recommendation of how IHC experiments have to be performed. For example the following reference have not used this method when staining human cancer tissue:

    Birgersdotter A et al. Inflammation and tissue repair markers distinguish the nodular sclerosis and mixed cellularity subtypes of classical Hodgkin's lymphoma. Br J Cancer 101:1393-401 (2009). PubMed: 19773754

    The information is provided as a guideline only and optimization is likely to be required depending on the tissue and protocol used by the customer. More information on how to optimize IHC experiments can be found from the following link:

    https://www.abcam.com/index.html?pageconfig=resource&rid=11384

    I hope this information has been of help. If you require any further information please do not hesitate to contact us again.

    Read More

    Abcam Scientific Support

    Answered on Jun 18 2012

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2022 Abcam plc. All rights reserved.