Overview

  • Product name

  • Description

    Rabbit polyclonal to Cathepsin K
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Cynomolgus monkey, Rhesus monkey
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Cathepsin K aa 54-317. Expressed in E.coli.
    Sequence:

    MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFLKYISIHNLEASLG VHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPD SVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNL VDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGK AAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDE SCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNA


    Database link: P43235

  • Positive control

    • WB: Recombinant human CTSK protein; pig heart tissue. IHC-P: Human breast cancer, prostate cancer, liver and lung cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231590 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 37 kDa.

Target

  • Function

    Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation.
  • Tissue specificity

    Predominantly expressed in osteclasts (bones).
  • Involvement in disease

    Defects in CTSK are the cause of pycnodysostosis (PKND) [MIM:265800]. PKND is an autosomal recessive osteochondrodysplasia characterized by osteosclerosis and short stature.
  • Sequence similarities

    Belongs to the peptidase C1 family.
  • Cellular localization

    Lysosome.
  • Information by UniProt
  • Database links

    see all
  • Alternative names

    • Cathepsin K antibody
    • Cathepsin O antibody
    • Cathepsin O1 antibody
    • Cathepsin O2 antibody
    • Cathepsin X antibody
    • CATK_HUMAN antibody
    • CTS02 antibody
    • Ctsk antibody
    • CTSO antibody
    • CTSO1 antibody
    • CTSO2 antibody
    • MGC23107 antibody
    • PKND antibody
    • PYCD antibody
    see all

Images

  • Anti-Cathepsin K antibody (ab231590) at 3 µg/ml + Recombinant human Cathepsin K protein

    Predicted band size: 37 kDa

  • Anti-Cathepsin K antibody (ab231590) at 3 µg/ml + Pig heart tissue

    Secondary
    HRP-linked guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 37 kDa

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for Cathepsin K using ab231590 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate cancer tissue stained for Cathepsin K using ab231590 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for Cathepsin K using ab231590 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human lung cancer tissue stained for Cathepsin K using ab231590 at 20 µg/mL in immunohistochemical analysis. DAB staining.

References

ab231590 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231590.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up