Overview

  • Product name

  • Description

    Rabbit polyclonal to Cathepsin K
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Dog, Human
    Predicted to work with: Rabbit, Cow, Pig, Cynomolgus monkey, Rhesus monkey
  • Immunogen

    Recombinant fragment corresponding to Dog Cathepsin K aa 71-319. N-terminal His-tag and GST-tag. Expressed in E.coli.
    Sequence:

    TYELAMNHLGDMTSEEVVQKMTGLKVPPSHSRSNDTLYIPDWESRAPDSV DYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVD CVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQDESCMYNPTGKAA KCRGYREIPEGNEKALKRAVARVGPISVAIDASLTSFQFYSKGVYYDENC NSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNAC


    Database link: Q3ZKN1

  • Positive control

    • WB: Recombinant dog Cathepsin K protein and MCF7 whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab233526 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 37 kDa.

Target

Images

  • Anti-Cathepsin K antibody (ab233526) at 2 µg/ml + Recombinant dog Cathepsin K protein

    Predicted band size: 37 kDa

  • Anti-Cathepsin K antibody (ab233526) at 5 µg/ml + MCF7 (human breast adenocarcinoma cell line) whole cell lysate

    Developed using the ECL technique.

    Predicted band size: 37 kDa

References

ab233526 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233526.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up