Overview

  • Product name

    Anti-Cathepsin K antibody [C1]
    See all Cathepsin K primary antibodies
  • Description

    Mouse monoclonal [C1] to Cathepsin K
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat, Human, Pig
    Predicted to work with: Rabbit, Cow, Dog, Cynomolgus monkey, Rhesus monkey
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human Cathepsin K aa 115-329. N-terminal His-tag (Expressed in E.coli).
    Sequence:

    APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSP QNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNP TGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVY YDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNK NNACGIANLASFPKM


    Database link: P43235

  • Positive control

    • WB: Human lung lysate; Pig uterus and heart lysates; Rat skeletal muscle lysate; Recombinant human Cathepsin K protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab239506 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 37 kDa.

Target

Images

  • Anti-Cathepsin K antibody [C1] (ab239506) at 3 µg/ml + Pig uterus lysate

    Predicted band size: 37 kDa

  • Anti-Cathepsin K antibody [C1] (ab239506) at 3 µg/ml + Pig heart lysate

    Predicted band size: 37 kDa

  • Anti-Cathepsin K antibody [C1] (ab239506) at 3 µg/ml + Rat skeletal muscle lysate

    Predicted band size: 37 kDa

  • Anti-Cathepsin K antibody [C1] (ab239506) at 2 µg/ml + Recombinant human Cathepsin K protein

    Secondary
    HRP-Linked Rabbit Anti-Mouse IgG at 1/5000 dilution

    Predicted band size: 37 kDa

  • Anti-Cathepsin K antibody [C1] (ab239506) at 2 µg/ml + Human lung lysate

    Secondary
    HRP-Linked Rabbit Anti-Mouse IgG at 1/5000 dilution

    Predicted band size: 37 kDa

References

ab239506 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239506.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up