Overview

  • Product name

  • Description

    Rabbit polyclonal to Cathepsin S
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Pig
    Predicted to work with: Cow, Dog
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Cow Cathepsin S aa 115-331. Expressed in E.coli.
    Sequence:

    LPDSMDWREKGCVTEVKYQGACGSCWAFSAVGALEAQVKLKTGKLVSLSA QNLVDCSTAKYGNKGCNGGFMTEAFQYIIDNNGIDSEASYPYKAMDGKCQ YDVKNRAATCSRYIELPFGSEEALKEAVANKGPVSVGIDASHSSFFLYKT GVYYDPSCTQNVNHGVLVVGYGNLDGKDYWLVKNSWGLHFGDQGYIRMAR NSGNHCGIANYPSYPEI


    Database link: P25326

  • Positive control

    • WB: Recombinant cow Cathepsin S protein; Mouse liver lysate; Pig spleen lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab232740 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 37 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Anti-Cathepsin S antibody (ab232740) at 2 µg/ml + Recombinant cow Cathepsin S protein.

    Predicted band size: 37 kDa

  • Anti-Cathepsin S antibody (ab232740) at 2 µg/ml + Mouse liver lysate.

    Developed using the ECL technique.

    Predicted band size: 37 kDa

  • Anti-Cathepsin S antibody (ab232740) at 1 µg/ml + Pig spleen tissue lysate.

    Developed using the ECL technique.

    Predicted band size: 37 kDa

References

ab232740 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232740.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up