Overview

  • Product name

  • Description

    Rabbit polyclonal to Cathepsin S
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Dog
  • Immunogen

    Recombinant full length protein corresponding to Human Cathepsin S aa 115-331. (Expressed in E.coli).
    Sequence:

    LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSA QNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQ YDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRS GVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMAR NKGNHCGIASFPSYPEI


    Database link: P25774

  • Positive control

    • IHC-P: Human colorectal cancer, stomach cancer, stomach, kidney and glioma tissues. WB: Human lung and thymus lysates; PANC-1 cell lysate; Recombinant human Cathepsin S protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab232830 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 37 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Paraffin-embedded human colorectal cancer tissue stained for Cathepsin S using ab232830 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human stomach cancer tissue stained for Cathepsin S using ab232830 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human stomach tissue stained for Cathepsin S using ab232830 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human kidney tissue stained for Cathepsin S using ab232830 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human glioma tissue stained for Cathepsin S using ab232830 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Cathepsin S antibody (ab232830) at 2 µg/ml + Recombinant human Cathepsin S protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 37 kDa

  • All lanes : Anti-Cathepsin S antibody (ab232830) at 2 µg/ml

    Lane 1 : Human lung lysate
    Lane 2 : PANC-1 (human pancreatic epithelial carcinoma cell line) cell lysate
    Lane 3 : Human thymus lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 37 kDa

References

ab232830 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232830.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up