Overview

  • Product name

  • Description

    Rabbit polyclonal to Cathepsin Z
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human Cathepsin Z aa 150-235.
    Sequence:

    PDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGR EKMMAEIYANGPISCGIMATERLANYTGGIYAEYQD


    Database link: Q9UBR2

  • Positive control

    • Human small intestine tissue; A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab204303 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of paraffin-embedded Human small intestine tissue labeling Cathepsin Z with ab204303 at a 1/50 dilution.

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized A431 cells labeling Cathepsin Z with ab204303 at 4 µg/ml (green).

References

ab204303 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204303.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up