Overview

  • Product name

    Anti-Caytaxin antibody
  • Description

    Rabbit polyclonal to Caytaxin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Horse, Chicken, Cow, Cat, Dog, Pig, Saccharomyces cerevisiae
  • Immunogen

    Synthetic peptide corresponding to Human Caytaxin aa 308-357 (C terminal).
    Sequence:

    LIPMEHVQIPDCVLQYEEERLKARRESARPQPEFVLPRSEEKPEVAPVEN


    Database link: NP_149053

  • Positive control

    • ACHN cell lysate
  • General notes

    Previously labelled as ATCAY.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab113923 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 42 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Involvement in disease

    Defects in ATCAY are the cause of cerebellar ataxia, cayman type (ATCAY) [MIM:601238]. ATCAY is found in a population isolate on Grand Cayman Island and causes a marked psychomotor retardation and prominent nonprogressive cerebellar dysfunction including nystagmus, intention tremor, dysarthria, and wide-based ataxic gait. Hypotonia is present from early childhood.
  • Sequence similarities

    Contains 1 CRAL-TRIO domain.
  • Domain

    The CRAL-TRIO domain is known to bind small hydrophobic molecules.
  • Information by UniProt
  • Database links

  • Alternative names

    • Ataxia Cayman type protein antibody
    • Ataxia, cerebellar, Cayman type antibody
    • Atcay antibody
    • ATCAY_HUMAN antibody
    • BNIP 2 homolgy antibody
    • BNIP 2 homology antibody
    • BNIP H antibody
    • BNIP-H antibody
    • Cayman ataxia antibody
    • Caytaxin antibody
    • CLAC antibody
    see all

Images

  • Anti-Caytaxin antibody (ab113923) at 1 µg/ml + ACHN cell lysate at 10 µg

    Predicted band size: 42 kDa



    Gel concentration 12%

References

ab113923 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113923.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up