Overview

  • Product name

    Anti-CBF1 interacting corepressor/CIR1 antibody - N-terminal
    See all CBF1 interacting corepressor/CIR1 primary antibodies
  • Description

    Rabbit polyclonal to CBF1 interacting corepressor/CIR1 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken
  • Immunogen

    Recombinant fragment corresponding to Human CBF1 interacting corepressor/CIR1 aa 1-160 (N terminal).
    Sequence:

    MGKSFANFMCKKDFHPASKSNIKKVWMAEQKISYDKKKQEELMQQYLKEQ ESYDNRLLMGDERVKNGLNFMYEAPPGAKKENKEKEETEGETEYKFEWQK GAPREKYAKDDMNIRDQPFGIQVRNVRCIKCHKWGHVNTDRECPLFGLSG INASSVPTDG


    Database link: Q86X95

  • Positive control

    • WB: PC-3 and HEK-293T whole cell lysates. IHC-P: Human endometrial cancer and lung tissues.
  • General notes

     This product was previously labelled as CBF1 interacting corepressor

     

Properties

Applications

Our Abpromise guarantee covers the use of ab229866 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 23,52 kDa.

Target

Images

  • Paraffin-embedded human endometrial cancer tissue stained for CBF1 interacting corepressor/CIR1 using ab229866 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lung tissue stained for CBF1 interacting corepressor/CIR1 using ab229866 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-CBF1 interacting corepressor/CIR1 antibody - N-terminal (ab229866) at 1/1000 dilution

    Lane 1 : PC-3 (human prostate adenocarcinoma cell line) whole cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 23,52 kDa

References

ab229866 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229866.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up