Overview

  • Product name

  • Description

    Rabbit polyclonal to CBFb
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human CBFb aa 1-182. N-terminal tags. Expressed in E.coli.
    Sequence:

    MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRD GRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAP MILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQEDALAQQAFEEARRRT REFEDRDRSHREEMEVRVSQLLAVTGKKTTRP


    Database link: Q13951

  • Positive control

    • WB: Recombinant human CBFb protein; K562 and Jurkat cell lysates. IHC-P: Human kidney and stomach tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231941 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml.

Target

  • Function

    CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL3 and GM-CSF promoters. CBFB enhances DNA binding by RUNX1.
  • Involvement in disease

    Note=A chromosomal aberration involving CBFB is associated with acute myeloid leukemia of M4EO subtype. Pericentric inversion inv(16)(p13;q22). The inversion produces a fusion protein that consists of the 165 N-terminal residues of CBF-beta (PEPB2) with the tail region of MYH11.
  • Sequence similarities

    Belongs to the CBF-beta family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CBF b antibody
    • CBF beta antibody
    • CBF-beta antibody
    • CBFB antibody
    • CBFbeta antibody
    • Core binding factor beta subunit antibody
    • core binding factor subunit beta antibody
    • Core-binding factor subunit beta antibody
    • Core-binding factor, beta subunit (CBFB), transcript variant 2 antibody
    • PEA 2 antibody
    • PEA2 antibody
    • PEA2 beta antibody
    • PEA2-beta antibody
    • PEA2beta antibody
    • PEBB_HUMAN antibody
    • PEBP 2B antibody
    • PEBP2 beta antibody
    • PEBP2-beta antibody
    • PEBP2B antibody
    • PEBP2beta antibody
    • Polyomavirus enhancer binding protein 2 beta subunit antibody
    • Polyomavirus enhancer-binding protein 2 beta subunit antibody
    • SL3 3 enhancer factor 1 beta subunit antibody
    • SL3 3 enhancer factor 1 subunit beta antibody
    • SL3-3 enhancer factor 1 subunit beta antibody
    • SL3/AKV core binding factor beta subunit antibody
    • SL3/AKV core-binding factor beta subunit antibody
    see all

Images

  • All lanes : Anti-CREM antibody (ab231741) at 1 µg/ml

    Lane 1 : K562 (Human chronic myelogenous leukemia cell line from bone marrow) cell lysate
    Lane 2 : Jurkat (Human T cell leukemia cell line from peripheral blood) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution
  • Formalin-fixed, paraffin embedded human stomach tissue stained for CBFb using ab231941 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin embedded human kidney tissue stained for CBFb using ab231941 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-CBFb antibody (ab231941) at 1 µg/ml + Recombinant human CBFb protein

References

ab231941 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231941.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up