Overview

  • Product name

    Anti-CBR4 antibody
  • Description

    Rabbit polyclonal to CBR4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human CBR4 aa 1-237.
    Sequence:

    MDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDH LAFSCDVAKEHDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDM VSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSA SKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKEEHLKKNIPL GRFGETIEVAHAVVFLLESPYITGHVLVVDGGLQLIL


    Database link: Q8N4T8

  • Positive control

    • IHC-P: Human liver cancer and gastric cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab230278 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    The heteroteramer with HSD17B8 has NADH-dependent 3-ketoacyl-acyl carrier protein reductase activity. May play a role in biosynthesis of fatty acids in mitochondria. The homotetramer may act as NADPH-dependent quinone reductase. Has broad substrate specificity and reduces 9,10-phenanthrenequinone, 1,4-benzoquinone and various other o-quinones and p-quinones (in vitro).
  • Tissue specificity

    Detected in liver and kidney (at protein level).
  • Pathway

    Lipid metabolism; fatty acid biosynthesis.
  • Sequence similarities

    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • 3 oxoacyl [acyl carrier protein] reductase antibody
    • 3-oxoacyl-[acyl-carrier-protein] reductase antibody
    • Carbonic reductase 4 antibody
    • Carbonyl reductase 4 antibody
    • Carbonyl reductase family member 4 antibody
    • CBR 4 antibody
    • Cbr4 antibody
    • CBR4_HUMAN antibody
    • FLJ14431 antibody
    • Quinone reductase CBR4 antibody
    • SDR45C1 antibody
    • Short chain dehydrogenase/reductase family 45C member 1 antibody
    see all

Images

  • Paraffin-embedded human liver cancer tissue stained for CBR4 using ab230278 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human gastric cancer tissue stained for CBR4 using ab230278 at 1/100 dilution in immunohistochemical analysis.

References

ab230278 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230278.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up