Overview

  • Product name

  • Description

    Rabbit polyclonal to CBWD2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human CBWD2 aa 96-395.
    Sequence:

    ELYEEWLELRNGCLCCSVKDNGLRAIENLMQKKGKFDYILLETTGLADPG AVASMFWVDAELGSDIYLDGIITIVDSKYGLKHLAEEKPDGLINEATRQV ALADAILINKTDLVPEEDVKKLRATIRSINGLGQILETQRSRVDLSNVLD LHAFDSLSGISLQKKLQHVPGTQPHLDQSIVTITFEVPGNAKEEHLNMFI QNLLWEKNVRNKDNHCMEVIRLKGLVSIKDKSQQVIVQGVHELYDLEETP VSWKDDTERTNRLVLLGRNLDKDILKQLFIATVTETEKQWTTHFKEDQVC T


    Database link: Q8IUF1

  • Positive control

    • WB: Mouse heart, liver and lung tissue lysates; HeLa whole cell lysate. IHC-P: Human prostate cancer and tonsil tissues. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237050 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 44 kDa.

Target

Images

  • All lanes : Anti-CBWD2 antibody (ab237050) at 1/1000 dilution

    Lane 1 : Mouse heart tissue lysate
    Lane 2 : Mouse liver tissue lysate
    Lane 3 : Mouse lung tissue lysate
    Lane 4 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 44 kDa

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for CBWD2 (green) using ab237050 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human prostate cancer tissue stained for CBWD2 using ab237050 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human tonsil tissue stained for CBWD2 using ab237050 at 1/100 dilution in immunohistochemical analysis.

References

ab237050 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237050.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up