Overview

  • Product name

    Anti-CBX1 / HP1 beta antibody (Biotin)
    See all CBX1 / HP1 beta primary antibodies
  • Description

    Mouse Monoclonal to CBX1 / HP1 beta (Biotin)
  • Host species

    Mouse
  • Conjugation

    Biotin
  • Specificity

    ab200940 was developed against a fully folded protein domain, so it does not show good reactivity against denatured proteins, and may not work in western blot applications.
  • Tested applications

    Suitable for: MS, IPmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human CBX1/ HP1 beta aa 104-174.
    Sequence:

    KEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEAN VKCPQVVISFYEERLTWHSYP


    Database link: P83916

  • Positive control

    • HEK293 cells.
  • General notes

    This product consists of purified Fab fragments which do not have an Fc domain that can be used for detection by secondary reagents. To enable simple and robust detection, the Fab fragments are specifically biotinylated on the C-terminus of the heavy chain. The extremely strong and specific interaction between biotin and streptavidin enables any streptavidin conjugated secondary reagent to be used for detection.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Clonality

    Monoclonal
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab200940 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
MS Use at an assay dependent concentration.
IP Use at an assay dependent concentration.

2 μg per IP.

Target

  • Function

    Component of heterochromatin. Recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression. Interaction with lamin B receptor (LBR) can contribute to the association of the heterochromatin with the inner nuclear membrane.
  • Tissue specificity

    Expressed in all adult and embryonic tissues.
  • Sequence similarities

    Contains 2 chromo domains.
  • Post-translational
    modifications

    Not phosphorylated.
    Ubiquitinated.
  • Cellular localization

    Nucleus. Unassociated with chromosomes during mitosis.
  • Information by UniProt
  • Database links

  • Alternative names

    • CBX 1 antibody
    • CBX antibody
    • Cbx1 antibody
    • CBX1_HUMAN antibody
    • Chromobox 1 antibody
    • Chromobox homolog 1 (HP1 beta homolog Drosophila ) antibody
    • chromobox homolog 1 antibody
    • Chromobox protein homolog 1 antibody
    • Drosophila HP1 beta antibody
    • Heterochromatin protein 1 beta antibody
    • Heterochromatin protein 1 homolog beta antibody
    • Heterochromatin protein p25 antibody
    • heterochromatin protein p25 beta antibody
    • HP1 beta antibody
    • HP1 beta homolog antibody
    • HP1 beta homolog Drosophila antibody
    • HP1, Drosophila. homolog of, beta antibody
    • HP1beta antibody
    • HP1Hs beta antibody
    • HP1Hsbeta antibody
    • Human heterochromatin protein p25 mRNA complete cds antibody
    • M31 antibody
    • MOD 1 antibody
    • MOD1 antibody
    • Modifier 1 protein antibody
    • p25beta antibody
    see all

References

ab200940 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200940.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up