Overview

  • Product name

    Anti-Cbx6 antibody [8D10A3]
    See all Cbx6 primary antibodies
  • Description

    Mouse monoclonal [8D10A3] to Cbx6
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Cbx6 aa 269-412. (Expressed in E.coli).
    Sequence:

    DARSSGSSGCPSPTPQSSDPDDTPPKLLPETVSPSAPSWREPEVLDLSLP PESAATSKRAPPEVTAAAGPAPPTAPEPAGASSEPEAGDWRPEMSPCSNV VVTDVTSNLLTVTIKEFCNPEDFEKVAAGVAGAAGGGGSIGASK


    Database link: O95503

  • Positive control

    • WB: Human Cbx6 (aa 269-412) recombinant protein; Cbx6 (aa 269-412)-hIgGFc transfected HEK-293 cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    8D10A3
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234063 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/500. Predicted molecular weight: 44 kDa.

Target

  • Function

    Involved in maintaining the transcriptionally repressive state of genes. Modifies chromatin, rendering it heritably changed in its expressibility.
  • Sequence similarities

    Contains 1 chromo domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cbx 6 antibody
    • Cbx6 antibody
    • CBX6_HUMAN antibody
    • Chromobox homolog 6 antibody
    • Chromobox protein homolog 6 antibody
    see all

Images

  • All lanes : Anti-Cbx6 antibody [8D10A3] (ab234063) at 1/100 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : Cbx6 (aa 269-412)-hIgGFc transfected HEK-293 cell lysate

    Predicted band size: 44 kDa

  • Anti-Cbx6 antibody [8D10A3] (ab234063) at 1/100 dilution + Human Cbx6 (aa 269-412) recombinant protein

    Predicted band size: 44 kDa



    Expected recombinant MW is 40.3 kDa.

References

ab234063 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234063.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up