Overview

  • Product name

  • Description

    Sheep polyclonal to CCBL1
  • Host species

    Sheep
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human CCBL1 aa 182-422. (Derived from S.frugiperda insect ovarian cell line Sf 21).
    Sequence:

    TPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIAS LPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCP TQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKP IIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPV SIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVEL


    Database link: Q16773

  • Positive control

    • Mouse kidney lysate.

Properties

  • Form

    Lyophilised:Reconstitute the antibody with 100 uL sterile PBS and the final concentration is 500 ug/mL. Reconstituted antibody can be aliquoted and stored frozen at < -20 °C for at least for six months without detectable loss of activity
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: 100% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    The IgG fraction of immunized serum was purified by antigen affinity chromatography and lyophilized from a 0.2 µm filtered solution in phosphate-buffered saline (PBS).
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab215056 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Detects a band of approximately 45 kDa (predicted molecular weight: 48 kDa).

Target

  • Relevance

    CCBL1 is a cytosolic enzyme which is responsible for the metabolism of cysteine conjugates of certain halogenated alkenes and alkanes. This metabolism leads to the formation of reactive metabolites which can lead to nephrotoxicity and neurotoxicity. CCBL1 catalyzes the irreversible transamination of the L-tryptophan metabolite L-kinurenine to form kynurenic acid (KA). It catalyzes the beta-elimination of S-conjugates and Se-conjugates of L-(seleno)cysteine, resulting in the cleavage of the C-S or C-Se bond. This enzyme has a central role in the bioactivation of nephrotoxic halogenated hydrocarbons - the possibility of human exposure to these chemicals has focused interest on the CCBL1 from human kidney.
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • Beta lyase antibody
    • Beta lysase, kidney antibody
    • CCBL 1 antibody
    • Cysteine conjugate beta lyase antibody
    • Cysteine conjugate beta lyase, cytoplasmic antibody
    • Cysteine conjugate beta lyase; cytoplasmic (glutamine transaminase K, kyneurenine aminotransferase) antibody
    • Cysteine S conjugate beta lyase antibody
    • Cytoplasmic cysteine conjugate beta lyase antibody
    • FLJ95217 antibody
    • Glutamine phenylpyruvate aminotransferase antibody
    • Glutamine transaminase K antibody
    • GTK antibody
    • KAT1 antibody
    • KATI antibody
    • Kyneurenine aminotransferase antibody
    • Kynurenine aminotransferase I antibody
    • Kynurenine oxoglutarate transaminase 1 antibody
    • MGC29624 antibody
    • OTTHUMP00000022311 antibody
    • OTTHUMP00000022312 antibody
    see all

Images

References

ab215056 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215056.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up