Overview

  • Product name

  • Description

    Rabbit polyclonal to CCDC124
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human CCDC124 aa 34-112.
    Sequence:

    LEDAYWKDDDKHVMRKEQRKEEKEKRRLDQLERKKETQRLLEEEDSKLKG GKAPRVATSSKVTRAQIEDTLRRDHQLRE


    Database link: Q96CT7

  • Positive control

    • Human hippocampus tissue; U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab184771 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/2500 - 1/5000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

Images

  • Immunofluorescent analysis of PFA/Triton X-100 fixed U-2 OS cells labeling CCDC124 with ab184771 at 4 µg/ml.

  • Immunohistochemical analysis of paraffin embedded Human hippocampus tissue labeling CCDC124 with ab184771 at 1/2500.

References

This product has been referenced in:

  • Wang YJ  et al. Lso2 is a conserved ribosome-bound protein required for translational recovery in yeast. PLoS Biol 16:e2005903 (2018). Read more (PubMed: 30208026) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab184771.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up