Overview

  • Product name

  • Description

    Rabbit polyclonal to CCDC21
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CCDC21 aa 518-612.
    Sequence:

    SLLEETQAICREKEIQLESLRQREAEFSSAGHSLQDKQSVEETSGEGPEV EMESWQKRYDSLQKIVEKQQQKMDQLRSQVQSLEQEVAQEEGTSQ


    Database link: Q6P2H3

  • Positive control

    • IHC-P: Human pancreas tissue. ICC/IF: U-251 MG cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224755 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Sequence similarities

    Belongs to the CEP85 family.
  • Cellular localization

    Cytoplasm > cytoskeleton > centrosome. Cytoplasm > cytoskeleton > spindle pole. Nucleus > nucleolus. Localizes to centrosomes and nucleolus in interphase. Upon entry into mitosis, relocates from nucleolus and accumulates at spindle poles.
  • Information by UniProt
  • Database links

  • Alternative names

    • CCDC21 antibody
    • Centrosomal protein of 85 kDa antibody
    • CEP85 antibody
    • CEP85_HUMAN antibody
    • Coiled-coil domain containing 21 antibody
    • Coiled-coil domain-containing protein 21 antibody
    • DKFZp434L0117 antibody
    • DKFZp434P232 antibody
    • FLJ13976 antibody
    • FLJ22000 antibody
    • OTTHUMP00000003454 antibody
    • OTTHUMP00000003455 antibody
    • OTTHUMP00000003456 antibody
    • OTTHUMP00000003457 antibody
    see all

Images

  • Paraffin-embedded human pancreas tissue stained for CCDC21 using ab224755 at 1/50 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for CCDC21 (green) using ab224755 at 4 µg/ml in ICC/IF.

References

ab224755 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224755.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up