Overview

  • Product name

  • Description

    Rabbit polyclonal to CCDC22/JM1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human CCDC22/JM1 aa 86-204.
    Sequence:

    YQNFLYPSEPDLRDLLLFLAERLPTDASEDADQPAGDSAILLRAIGSQIR DQLALPWVPPHLRTPKLQHLQGSALQKPFHASRLVVPELSSRGEPREFQA SPLLLPVPTQVPQPVGRVA


    Database link: O60826

  • Positive control

    • IHC: Human stomach tissue. WB: RT4, NIH/3T3, NBT-II and PC-12 whole cell lysate. ICC/IF: A431 cells.
  • General notes

     This product was previously labelled as CCDC22

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224038 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/500 - 1/1000. Predicted molecular weight: 71 kDa.
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Anti-CCDC22/JM1 antibody (ab224038) at 1/500 dilution + RT4 (human urinary bladder cancer cell line) whole cell lysate

    Predicted band size: 71 kDa

  • Paraffin-embedded human stomach tissue stained for CCDC22/JM1 using ab224038 at 1/500 dilution in immunohistochemical analysis.

  • All lanes : Anti-CCDC22/JM1 antibody (ab224038) at 1/500 dilution

    Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) whole cell lysate
    Lane 2 : NBT-II (rat cell line) whole cell lysate
    Lane 3 : PC-12 (rat adrenal gland pheochromocytoma cell line) whole cell lysate

    Predicted band size: 71 kDa

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for CCDC22/JM1 (green) using ab224038 at 4 µg/ml in ICC/IF.

References

ab224038 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224038.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up