Overview

  • Product name

    Anti-CCDC34/L15 antibody
  • Description

    Rabbit polyclonal to CCDC34/L15
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CCDC34/L15 aa 92-191 (internal sequence).
    Sequence:

    DEEDVDEDAHDSEAKVASLRGMELQGCASTQVESENNQEEQKQVRLPESR LTPWEVWFIGKEKEERDRLQLKALEELNQQLEKRKEMEEREKRKIIAE EK


    Database link: Q96HJ3

  • Positive control

    • IHC-P: Human cerebral cortex tissue WB: RT4 and U251 MG cell lysates.
  • General notes

     This product was previously labelled as CCDC34

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab122396 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

WB 1/250 - 1/500.
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Involvement in disease

    Note=A chromosomal aberration involving CCDC34 is found in a patient with hamartoma of the retinal pigment epithelium and retina. Translocation t(11;18) (p13;p11.2).
  • Information by UniProt
  • Database links

  • Alternative names

    • CCD34_HUMAN antibody
    • Ccdc34 antibody
    • Coiled-coil domain-containing protein 34 antibody
    • L15 antibody
    • NY-REN-41 antibody
    • RAMA3 antibody
    • Renal carcinoma antigen NY-REN-41 antibody
    see all

Images

  • All lanes : Anti-CCDC34/L15 antibody (ab122396) at 1/250 dilution

    Lane 1 : RT4 cell lysate
    Lane 2 : U251 MG cell lysate
    Lane 3 : Human Plasma cell lysate
    Lane 4 : Liver cell lysate
    Lane 5 : Tonsil cell lysate
  • Immunofluorescent staining of Human cell line U-251 MG shows positivity in nucleus, nucleoli and nuclear membrane. Recommended concentration of ab122396 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • ab122430, at 1/500, staining CCDC34/L15 in paraffin embedded Human cerebral cortex tissue by immunohistochemistry.

References

This product has been referenced in:

  • Hu DD  et al. Overexpression of Coiled-Coil Domain-Containing Protein 34 (CCDC34) and its Correlation with Angiogenesis in Esophageal Squamous Cell Carcinoma. Med Sci Monit 24:698-705 (2018). Read more (PubMed: 29397026) »
  • Liu LB  et al. High Expression of CCDC34 Is Associated with Poor Survival in Cervical Cancer Patients. Med Sci Monit 24:8383-8390 (2018). Read more (PubMed: 30458457) »
See all 5 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab122396.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up