Anti-CCDC39 antibody (ab122269)
Key features and details
- Rabbit polyclonal to CCDC39
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-CCDC39 antibody -
Description
Rabbit polyclonal to CCDC39 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human CCDC39 aa 191-288.
Sequence:ILDNELTETISAQLELDKAAQDFRKIHNERQELIKQWENTIEQMQKRDGD IDNCALELARIKQETREKENLVKEKIKFLESEIGNNTEFEKRISVADR
Database link: Q9UFE4 -
Positive control
- RT-4 lysate, Human pancreas tissue
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab122269 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Use a concentration of 0.04 - 0.4 µg/ml.
|
|
IHC-P |
1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
Notes |
---|
WB
Use a concentration of 0.04 - 0.4 µg/ml. |
IHC-P
1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Required for assembly of dynein regulatory complex (DRC) and inner dynein arm complexes, which are responsible for ciliary beat regulation, thereby playing a central role in motility in cilia and flagella. Not required for outer dynein arm complexes assembly. -
Tissue specificity
Mainly expressed in nasal brushings and, to a lesser extent, in lungs and testis. -
Involvement in disease
Defects in CCDC39 are the cause of primary ciliary dyskinesia type 14 (CILD14) [MIM:613807]. A disorder characterized by abnormalities of motile cilia. Respiratory infections leading to chronic inflammation and bronchiectasis are recurrent, due to defects in the respiratory cilia; reduced fertility is often observed in male patients due to abnormalities of sperm tails. Half of the patients exhibit randomization of left-right body asymmetry and situs inversus, due to dysfunction of monocilia at the embryonic node. Primary ciliary dyskinesia associated with situs inversus is referred to as Kartagener syndrome. -
Sequence similarities
Belongs to the CCDC39 family. -
Cellular localization
Cytoplasm > cytoskeleton > cilium axoneme. CCDC40 is required for localization to axonemes. - Information by UniProt
-
Database links
- Entrez Gene: 339829 Human
- Omim: 613798 Human
- SwissProt: Q9UFE4 Human
- Unigene: 712820 Human
-
Alternative names
- CCD39_HUMAN antibody
- Ccdc39 antibody
- CILD141 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human bronchus tissue labelling CCDC39 with ab122269. Staining shows strong positivity in cilia of respiratory epithelial cells.
-
All lanes : Anti-CCDC39 antibody (ab122269) at 1/250 dilution
Lane 1 : RT-4 lysate
Lane 2 : U251-MG lysate
Lane 3 : Human plasma lysate
Lane 4 : Human liver lysate
Lane 5 : Human tonsil lysate
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab122269 has not yet been referenced specifically in any publications.