Overview

  • Product name

  • Description

    Rabbit polyclonal to CCDC41
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CCDC41 aa 34-260.
    Sequence:

    CEHHKANYQTLKAEHTRLQNEHVKLQNELKHLFNEKQTQQEKLQLLLEEL RGELVEKTKDLEEMKLQILTPQKLELLRAQIQQELETPMRERFRNLDEEV EKYRAVYNKLRYEHTFLKSEFEHQKEEYARILDEGKIKYESEIARLEEDK EELRNQLLNVDLTKDSKRVEQLAREKVYLCQKLKGLEAEVAELKAEKENS EAQVENAQRIQVRQLAEMQATVRSLEA


    Database link: Q9Y592

  • Positive control

    • WB: Raji whole cell lysate. IHC-P: Human kidney and brain tissue. ICC/IF: PC-3 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230386 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Detects a band of approximately 82, 55 kDa (predicted molecular weight: 82, 67 kDa).
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

Images

  • Anti-CCDC41 antibody (ab230386) at 1/500 dilution + Raji (human Burkitt's lymphoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 82, 67 kDa
    Observed band size: 55,82 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human kidney tissue stained for CCDC41 with ab230386 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human brain tissue stained for CCDC41 with ab230386 at 1/100 dilution in immunohistochemical analysis.

  • PC-3 (human prostate adenocarcinoma cell line) cells stained for CCDC41 (green) using ab230386 at 1/100 dilution in ICC/IF. Secondary: Alexa Fluor® 488-congugated AffiniPure Goat Anti-Rabbit IgG (H+L).

References

ab230386 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230386.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up