Overview

  • Product name
  • Description
    Rabbit polyclonal to CCDC41
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human CCDC41 aa 34-260.
    Sequence:

    CEHHKANYQTLKAEHTRLQNEHVKLQNELKHLFNEKQTQQEKLQLLLEEL RGELVEKTKDLEEMKLQILTPQKLELLRAQIQQELETPMRERFRNLDEEV EKYRAVYNKLRYEHTFLKSEFEHQKEEYARILDEGKIKYESEIARLEEDK EELRNQLLNVDLTKDSKRVEQLAREKVYLCQKLKGLEAEVAELKAEKENS EAQVENAQRIQVRQLAEMQATVRSLEA


    Database link: Q9Y592-1

  • Positive control
    • WB: Mouse liver lysate; COLO 205 whole cell lysate. IHC-P: Human kidney and brain tissues. ICC/IF: PC-3 cells.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230413 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 82 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

Images

  • All lanes : Anti-CCDC41 antibody (ab230413) at 1/500 dilution

    Lane 1 : Mouse liver lysate
    Lane 2 : COLO 205 (human colon adenocarcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 82 kDa

  • Paraffin-embedded human kidney tissue stained for CCDC41 using ab230413 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human brain tissue stained for CCDC41 using ab230413 at 1/100 dilution in immunohistochemical analysis.

  • PC-3 (human prostate adenocarcinoma cell line) cells stained for CCDC41 (green) using ab230413 at 1/100 dilution in ICC/IF, followed by an Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab230413 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230413.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up