Overview

  • Product name

  • Description

    Rabbit polyclonal to CCDC42
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human CCDC42 aa 1-242.
    Sequence:

    MSLGIMEEEDLAEYFRLQYGERLLQMLQKLPNVEGASESPSIWLLEKKKE TEIMHQTMVQKKKMFQRRMETLNLRWEELGVKEAQLKAHIQKSEQFIQEN DQKRIRAMKKANKERELKCQHMQELTKRKQEMVALRLEHQRLSAKLKDYY IFNKYLEKVVENSEESRWAHIQNTAAKKTLLLGTIKMATLNLFQIVSKHL KEVTEVALEDTHKQLDMIQQFIQDRSDIWAEVKKKEQQRVRI


    Database link: Q96M95

  • Positive control

    • WB: Mouse brain and heart lysates. IHC-P: Human testis tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235440 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 38 kDa.

Target

  • Relevance

    The function of this protein is not yet known.
  • Database links

  • Alternative names

    • A530001H01Rik antibody
    • CCDC42A antibody
    • Coiled coil domain containing 42 antibody
    • Coiled coil domain containing protein 42A antibody
    • FLJ32734 antibody
    • OTTMUSP00000006142 antibody
    • RGD1565925 antibody
    • RP23-400O5.1 antibody
    see all

Images

  • All lanes : Anti-CCDC42 antibody (ab235440) at 1/500 dilution

    Lane 1 : Mouse brain lysate
    Lane 2 : Mouse heart lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 38 kDa

  • Paraffin-embedded human testis tissue stained for CCDC42 using ab235440 at 1/100 dilution in immunohistochemical analysis.

References

ab235440 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235440.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up