Overview

  • Product name

  • Description

    Rabbit polyclonal to CCDC6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human CCDC6 aa 347-440.
    Sequence:

    PRTVSSPIPYTPSPSSSRPISPGLSYASHTVGFTPPTSLTRAGMSYYNSP GLHVQHMGTSHGITRPSPRRSNSPDKFKRPTPPPSPNTQTPVQP


    Database link: Q16204

  • Positive control

    • WB: MCF7 whole cell lysate. IHC-P: Human prostate cancer and small intestine tissues. ICC/IF: MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab235912 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 53 kDa.
ICC/IF 1/50 - 1/200.
IHC-P 1/500 - 1/1000.

Target

  • Tissue specificity

    Ubiquitously expressed.
  • Involvement in disease

    Defects in CCDC6 are a cause of thyroid papillary carcinoma (TPC) [MIM:188550]. TPC is a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue. Papillary carcinomas are malignant neoplasm characterized by the formation of numerous, irregular, finger-like projections of fibrous stroma that is covered with a surface layer of neoplastic epithelial cells. Note=A chromosomal aberration involving CCDC6 is found in thyroid papillary carcinomas. Inversion inv(10)(q11.2;q21) generates the RET/CCDC6 (PTC1) oncogene.
  • Domain

    The protein has mostly an alpha helical conformation similar to myosin heavy-chain tail that might adopt a coiled-coil conformation.
  • Cellular localization

    Cytoplasm. Cytoplasm > cytoskeleton. May be a cytoskeletal protein.
  • Information by UniProt
  • Database links

  • Alternative names

    • CCDC 6 antibody
    • CCDC6 antibody
    • CCDC6_HUMAN antibody
    • Coiled coil domain containing 6 antibody
    • Coiled coil domain containing protein 6 antibody
    • Coiled-coil domain-containing protein 6 antibody
    • D10S170 antibody
    • FLJ32286 antibody
    • H4 antibody
    • Papillary thyroid carcinoma encoded protein antibody
    • Papillary thyroid carcinoma-encoded protein antibody
    • Protein H4 antibody
    • PTC antibody
    • TPC antibody
    • TST 1 antibody
    • TST1 antibody
    see all

Images

  • Paraffin-embedded human prostate cancer tissue stained for CCDC6 with ab235912 at 1/500 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • Anti-CCDC6 antibody (ab235912) at 1/500 dilution + MCF7 (human breast adenocarcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 53 kDa

  • 4% formaldehyde-fixed,  0.2% Triton X-100 permeabilized MCF7 (human breast adenocarcinoma cell line) cells stained for CCDC6 using ab235912 at 1/166 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human small intestine tissue stained for CCDC6 with ab235912 at 1/500 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

References

ab235912 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235912.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up