Overview

  • Product name

  • Description

    Rabbit polyclonal to CCDC8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human CCDC8 aa 214-513.
    Sequence:

    APRAGPGVGEARLASTAVESAGVSSAPEGTSPGDRLGNAGDVCVPQASPR RWRPKINWASFRRRRKEQTAPTGQGADIEADQGGEAADSQREEAIADQRE GAAGNQRAGAPADQGAEAADNQREEAADNQRAGAPAEEGAEAADNQREEA ADNQRAEAPADQRSQGTDNHREEAADNQRAEAPADQGSEVTDNQREEAVH DQRERAPAVQGADNQRAQARAGQRAEAAHNQRAGAPGIQEAEVSAAQGTT GTAPGARARKQVKTVRFQTPGRFSWFCKRRRAFWHTPRLPTLPKRVPRAG


    Database link: Q9H0W5

  • Positive control

    • WB: Mouse liver tissue lysate. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222969 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/5000. Detects a band of approximately 60 kDa (predicted molecular weight: 59 kDa).
ICC/IF 1/50 - 1/200.

Target

Images

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for CCDC8 (green) using ab222969 at 1/100 dilution in ICC/IF. Secondary: Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  • Anti-CCDC8 antibody (ab222969) at 1/2000 dilution + Mouse liver tissue lysate

    Secondary
    Goat Anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 59 kDa
    Observed band size: 60 kDa
    why is the actual band size different from the predicted?

References

ab222969 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222969.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up