Overview

  • Product name

  • Description

    Rabbit polyclonal to CCDC80
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human CCDC80 aa 167-299.
    Sequence:

    MMSLLKDDVYCELAERHIQQIVLFHQAGEEGGKVRRITSEGQILEQPLDP SLIPKLMSFLKLEKGKFGMVLLKKTLQVEERYPYPVRLEAMYEVIDQGPI RRIEKIRQKGFVQKCKASGVEGQVVAEGNDGGG


    Database link: Q76M96

  • Positive control

    • IHC: Human heart muscle tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224050 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Promotes cell adhesion and matrix assembly.
  • Tissue specificity

    Expressed in dermal papilla and dermal fibroblasts (at protein level). Expressed in heart, thymus, placenta, pancreas, colon, epithelium, spleen and osteoblasts.
  • Sequence similarities

    Belongs to the CCDC80 family.
  • Post-translational
    modifications

    Phosphorylated.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2610001E17Rik antibody
    • CCD50 antibody
    • CCD80_HUMAN antibody
    • CCDC80 antibody
    • CL2 antibody
    • Coiled coil domain containing 80 antibody
    • Coiled coil domain containing protein 50 antibody
    • Coiled-coil domain-containing protein 80 antibody
    • Down regulated by oncogenes protein 1 antibody
    • Down-regulated by oncogenes protein 1 antibody
    • DRO1 antibody
    • MGC131805 antibody
    • MGC134851 antibody
    • Nuclear envelope protein okuribin antibody
    • okuribin antibody
    • OTTMUSP00000030743 antibody
    • Protein Ymer antibody
    • SSG1 antibody
    • steroid sensitive gene 1 antibody
    • steroid sensitive protein 1 antibody
    • Up-regulated in BRS-3 deficient mouse homolog antibody
    • URB antibody
    see all

Images

  • Paraffin-embedded human heart muscle tissue stained for CCDC80 using ab224050 at 1/50 dilution in immunohistochemical analysis.

References

ab224050 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224050.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up