Overview

  • Product name

  • Description

    Rabbit polyclonal to CCDC98
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CCDC98 aa 311-408.
    Sequence:

    CNYNHHLDVVDNLTLMVEHTDIPEASPASTPQIIKHKTLDLDDRWQFKRS RLLDTQDKRSKADTGSSNQDKASKMSSPETDEEIEKMKGFGEYSRSPT


    Database link: Q6UWZ7

  • Positive control

    • Human testis tissue. RT-4 and U-251 MG cell lysate. U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204307 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 47 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Function

    Component of the BRCA1-A complex, a complex that specifically recognizes 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). The BRCA1-A complex also possesses deubiquitinase activity that specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX. In the BRCA1-A complex, it acts as a central scaffold protein that assembles the various components of the BRCA1-A complex and mediates the recruitment of BRCA1.
  • Sequence similarities

    Belongs to the FAM175 family. Abraxas subfamily.
  • Domain

    The MPN-like region is similar to the MPN (JAB/Mov34) domain. Its presence reveals similarities between the structure of the 19S proteasome and the BRCA1-A complexes.
  • Post-translational
    modifications

    Phosphorylation of Ser-406 of the pSXXF motif by ATM or ATR constitutes a specific recognition motif for the BRCT domain of BRCA1. Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus. Localizes at sites of DNA damage at double-strand breaks.
  • Information by UniProt
  • Database links

  • Alternative names

    • 3830405G04Rik antibody
    • 5630400M01Rik antibody
    • ABRA1 antibody
    • ABRAXAS antibody
    • Abraxas protein antibody
    • AI506069 antibody
    • AL024423 antibody
    • AV118690 antibody
    • BRCA1-A complex subunit Abraxas antibody
    • coiled coil domain containing 98 antibody
    • Coiled-coil domain-containing protein 98 antibody
    • F175A_HUMAN antibody
    • FAM175A antibody
    • Family with sequence similarity 175 member A antibody
    • FLJ11520 antibody
    • FLJ12642 antibody
    • FLJ13614 antibody
    • Protein FAM175A antibody
    see all

Images

  • All lanes : Anti-CCDC98 antibody (ab204307) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate

    Predicted band size: 47 kDa

  • Immunofluorescent analysis of U-2 OS cells (PFA-fixed/Triton X-100 permeabilized) labeling CCDC98 with ab204307 at 4 µg/mL.

  • Immunohistochemical analysis of paraffin-embedded Human testis tissue labeling CCDC98 with ab204307 at 1/50 dilution.

References

ab204307 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204307.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up