Overview

  • Product name

    Anti-CCHCR1 antibody
  • Description

    Rabbit polyclonal to CCHCR1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla
  • Immunogen

    Recombinant fragment corresponding to Human CCHCR1 aa 483-782.
    Sequence:

    ALAQLRQESCPLPPPVTDVSLELQQLREERNRLDAELQLSARLIQQEVGR AREQGEAERQQLSKVAQQLEQELQQTQESLASLGLQLEVARQGQQESTEE AASLRQELTQQQELYGQALQEKVAEVETRLREQLSDTERRLNEARREHAK AVVSLRQIQRRAAQEKERSQELRRLQEEARKEEGQRLARRLQELERDKNL MLATLQQEGLLSRYKQQRLLTVLPSLLDKKKSVVSSPRPPECSASAPVAA AVPTRESIKGSLSVLLDDLQDLSEAISKEEAVCQGDNLDRCSSSNPQMSS


    Database link: Q8TD31

  • Positive control

    • WB: HEK-293T whole cell lysate. IHC-P: Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab230223 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 89 kDa (predicted molecular weight: 89 kDa).
IHC-P 1/20 - 1/200.

Target

  • Relevance

    CCHCR1 (Coiled coil alpha helical rod protein 1) is a regulator of keratinocyte proliferation or differentiation. It is overexpressed in keratinocytes in psoriatic lesions.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • a helix coiled coil rod homolog antibody
    • a helix coiled coil rod homologue antibody
    • Alpha helix coiled coil rod homolog antibody
    • Alpha helix coiled coil rod homologue antibody
    • C6orf18 antibody
    • CCHCR 1 antibody
    • CCHCR antibody
    • Coiled coil alpha helical rod protein 1 antibody
    • Coiled coil alpha helical rod protein1 antibody
    • HCR antibody
    • Pg 8 antibody
    • Pg8 antibody
    • Putative gene 8 protein antibody
    • SBP antibody
    • StAR binding protein antibody
    see all

Images

  • Anti-CCHCR1 antibody (ab230223) at 1/1000 dilution + HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 89 kDa

  • Paraffin-embedded human testis tissue stained for CCHCR1 using ab230223 at 1/100 dilution in immunohistochemical analysis.

References

ab230223 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230223.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up