Overview

  • Product name

  • Description

    Rabbit polyclonal to CCL21
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rhesus monkey
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human CCL21 aa 24-134 (N terminal). Mature chain lacking the signal peptide. (Expressed in E.coli).
    Sequence:

    SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAE LCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCK RTERSQTPKGP


    Database link: O00585

  • Positive control

    • WB: Recombinant human CCL21 protein; Mouse spleen lysate; Human lung lysate. IHC-P: Human lymph node tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231116 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 15 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Inhibits hemopoiesis and stimulates chemotaxis. Chemotactic in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Shows preferential activity towards naive T-cells. May play a role in mediating homing of lymphocytes to secondary lymphoid organs.
  • Tissue specificity

    Highly expressed in high endothelial venules of lymph nodes, spleen and appendix. Intermediate levels found in small intestine, thyroid gland and trachea. Low level expression in thymus, bone marrow, liver, and pancreas. Also found in tonsil, fetal heart and fetal spleen.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • 6Ckine antibody
    • Beta chemokine exodus 2 antibody
    • Beta-chemokine exodus-2 antibody
    • C C motif chemokine ligand 21 antibody
    • C-C motif chemokine 21 antibody
    • CCL21 antibody
    • CCL21_HUMAN antibody
    • Chemokine (C-C motif) ligand 21 antibody
    • Chemokine CC motif ligand 21 antibody
    • CKb9 antibody
    • ECL antibody
    • Efficient Chemoattractant for Lymphocytes antibody
    • SCYA21 antibody
    • Secondary lymphoid tissue chemokine antibody
    • Secondary lymphoid-tissue chemokine antibody
    • SLC antibody
    • Small inducible cytokine A21 antibody
    • Small inducible cytokine subfamily A (Cys-Cys), member 21 antibody
    • Small-inducible cytokine A21 antibody
    • TCA4 antibody
    • UNQ784/PRO1600 antibody
    see all

Images

  • DAB stained, formalin-fixed paraffin-embedded human lymph node tissue stained for CCL21 using ab231116 at 20 µg/mL in immunohistochemical analysis.

     

     

     

     

  • Anti-CCL21 antibody (ab231116) at 2 µg/ml + Human lung lysate

    Developed using the ECL technique.

    Predicted band size: 15 kDa

  • Anti-CCL21 antibody (ab231116) at 2 µg/ml + Mouse spleen lysate

    Developed using the ECL technique.

    Predicted band size: 15 kDa

  • Anti-CCL21 antibody (ab231116) at 2 µg/ml + Recombinant human CCL21 protein

    Developed using the ECL technique.

    Predicted band size: 15 kDa

References

ab231116 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231116.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up