Overview

  • Product name

    Anti-CCL27 antibody [6M35]
    See all CCL27 primary antibodies
  • Description

    Rat monoclonal [6M35] to CCL27
  • Host species

    Rat
  • Tested applications

    Suitable for: IHC-P, WB, Neutralisingmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Mouse CCL27 aa 26-120. NCBI Accession No. NP_001041644.
    Sequence:

    PWLRMWRRERSPMSPTSQRLSLEAPSLPLRSWHPWNKTKQKQEALPLPSS TSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRS


    Database link: A2AMS7

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: 100% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    6M35
  • Isotype

    IgG2
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab194649 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 19 kDa.
Neutralising Use at an assay dependent concentration.

Target

  • Function

    Chemotactic factor that attracts skin-associated memory T-lymphocytes. May play a role in mediating homing of lymphocytes to cutaneous sites. Binds to CCR10.
  • Tissue specificity

    Testis, thymus, placenta, ovary and skin.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • ALP antibody
    • C-C motif chemokine 27 antibody
    • CC chemokine ILC antibody
    • Ccl27 antibody
    • CCL27_HUMAN antibody
    • Chemokine (C-C motif) ligand 27 antibody
    • CTACK antibody
    • CTAK antibody
    • Cutaneous T cell attracting chemokine antibody
    • Cutaneous T-cell-attracting chemokine antibody
    • ESkine antibody
    • IL 11 R alpha locus chemokine antibody
    • IL-11 R-alpha-locus chemokine antibody
    • ILC antibody
    • PESKY antibody
    • SCYA27 antibody
    • Skinkine antibody
    • Small inducible cytokine A27 antibody
    • small inducible cytokine subfamily A (Cys-Cys), member 27 antibody
    • Small-inducible cytokine A27 antibody
    see all

References

This product has been referenced in:

  • García Nores GD  et al. CD4+ T cells are activated in regional lymph nodes and migrate to skin to initiate lymphedema. Nat Commun 9:1970 (2018). Read more (PubMed: 29773802) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194649.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up