Overview

  • Product name

  • Description

    Rabbit polyclonal to CCL28/MEC
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Mouse CCL28/MEC aa 17-130. N-terminal tags. Full length mature chain expressed in E.coli.
    Sequence:

    FQTSEAILPMASSCCTEVSHHVSGRLLERVSSCSIQRADGDCDLAAVILH VKRRRICISPHNRTLKQWMRASEVKKNGRENVCSGKKQPSRKDRKGHTTR KHRTRGTHRHEASR


    Database link: Q9JIL2

  • Positive control

    • IHC-P: Mouse testis tissue. WB: Mouse spleen lysate; Recombinant mouse CCL28/MEC protein.
  • General notes

     This product was previously labelled as CCL28

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231557 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231557 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 15 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Chemotactic activity for resting CD4, CD8 T-cells and eosinophils. Binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner.
  • Tissue specificity

    Preferentially expressed by epithelial cells of diverse tissues including normal and pathological colon, salivary gland, mammary gland, trachea and rectum. Also found in prostate, spleen, thyroid, psoriasis skin and in lower levels in peripheral blood leukocytes, small intestine, Peyer patches, stomach and normal skin.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • C C motif chemokine ligand 28 antibody
    • C-C motif chemokine 28 antibody
    • CC chemokine CCL28 antibody
    • CCK 1 antibody
    • CCK1 antibody
    • CCK1 protein antibody
    • CCL 28 antibody
    • CCL28 antibody
    • CCL28_HUMAN antibody
    • Chemokine (C-C motif) ligand 28 antibody
    • chemokine (C-C motif) ligand 28 splice variant chi antibody
    • MEC antibody
    • Mucosae associated epithelial chemokine antibody
    • Mucosae-associated epithelial chemokine antibody
    • Protein CCK1 antibody
    • SCYA28 antibody
    • Small inducible cytokine A28 [Precursor] antibody
    • small inducible cytokine subfamily A (Cys-Cys), member 28 antibody
    • Small-inducible cytokine A28 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse testis tissue stained for CCL28/MEC using ab231557 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-CCL28/MEC antibody (ab231557) at 2 µg/ml + Mouse spleen lysate

    Predicted band size: 15 kDa

  • Anti-CCL28/MEC antibody (ab231557) at 2 µg/ml + Recombinant mouse CCL28/MEC protein

    Predicted band size: 15 kDa

References

ab231557 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231557.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up