Anti-CCL4/MIP-1 beta antibody (ab106548)
Key features and details
- Rabbit polyclonal to CCL4/MIP-1 beta
- Suitable for: WB
- Reacts with: Recombinant fragment
- Isotype: IgG
Overview
-
Product name
Anti-CCL4/MIP-1 beta antibody
See all CCL4/MIP-1 beta primary antibodies -
Description
Rabbit polyclonal to CCL4/MIP-1 beta -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Recombinant fragment
Predicted to work with: Rat, Rabbit, Horse, Cow, Cat, Dog, Human, Pig, Chimpanzee, Macaque monkey, Opossum -
Immunogen
Recombinant full length protein corresponding to Pig CCL4/MIP-1 beta aa 24-92.
Sequence:APMGSDPPTSCCFTYTVRKLPRNFVTDYYETSSLCSQPAVVFQTKKGRQV CANPSDDWVQEYMDDLELN
-
Positive control
- Recombinant Pig CCL4/MIP-1 beta.
-
General notes
This product was previously labelled as Macrophage Inflammatory Protein 1 beta, MIP1 beta
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.01% Sodium azide
Constituents: 0.42% Potassium phosphate, 0.88% Sodium chloride -
Concentration information loading...
-
Purity
Protein A purified -
Purification notes
ab106548 was Protein A purified from monospecific antiserum by chromatography -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab106548 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500. Predicted molecular weight: 10 kDa. |
Target
-
Function
Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B. -
Sequence similarities
Belongs to the intercrine beta (chemokine CC) family. -
Post-translational
modificationsN-terminal processed form MIP-1-beta(3-69) is produced by proteolytic cleavage after secretion from peripheral blood lymphocytes. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 414347 Cow
- Entrez Gene: 448786 Dog
- Entrez Gene: 100057859 Horse
- Entrez Gene: 388372 Human
- Entrez Gene: 6351 Human
- Entrez Gene: 9560 Human
- Entrez Gene: 116637 Rat
- Omim: 182284 Human
see all -
Alternative names
- MIP 1 beta antibody
- Secreted protein G 26 antibody
- ACT 2 antibody
see all
Images
References (0)
ab106548 has not yet been referenced specifically in any publications.