For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    ccl4mip-1-beta-antibody-ab106548.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Innate Immunity Macrophage / Inflamm.
Share by email

Anti-CCL4/MIP-1 beta antibody (ab106548)

  • Datasheet
  • SDS
Submit a review Q&A (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-CCL4/MIP-1 beta antibody (ab106548)

    Key features and details

    • Rabbit polyclonal to CCL4/MIP-1 beta
    • Suitable for: WB
    • Reacts with: Recombinant fragment
    • Isotype: IgG

    You may also be interested in

    Secondary
    Product image
    Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
    Protein
    Recombinant human CCL4/MIP-1 beta protein (ab9676)

    View more associated products

    Overview

    • Product name

      Anti-CCL4/MIP-1 beta antibody
      See all CCL4/MIP-1 beta primary antibodies
    • Description

      Rabbit polyclonal to CCL4/MIP-1 beta
    • Host species

      Rabbit
    • Tested applications

      Suitable for: WBmore details
    • Species reactivity

      Reacts with: Recombinant fragment
      Predicted to work with: Rat, Rabbit, Horse, Cow, Cat, Dog, Human, Pig, Chimpanzee, Macaque monkey, Opossum
    • Immunogen

      Recombinant full length protein corresponding to Pig CCL4/MIP-1 beta aa 24-92.
      Sequence:

      APMGSDPPTSCCFTYTVRKLPRNFVTDYYETSSLCSQPAVVFQTKKGRQV CANPSDDWVQEYMDDLELN

      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
    • Positive control

      • Recombinant Pig CCL4/MIP-1 beta.
    • General notes

       This product was previously labelled as Macrophage Inflammatory Protein 1 beta, MIP1 beta

       

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
    • Storage buffer

      Preservative: 0.01% Sodium azide
      Constituents: 0.42% Potassium phosphate, 0.88% Sodium chloride
    • Concentration information loading...
    • Purity

      Protein A purified
    • Purification notes

      ab106548 was Protein A purified from monospecific antiserum by chromatography
    • Clonality

      Polyclonal
    • Isotype

      IgG
    • Research areas

      • Immunology
      • Innate Immunity
      • Macrophage / Inflamm.
      • Immunology
      • Innate Immunity
      • Chemokines
      • Beta Chemokines (CC)
      • Kits/ Lysates/ Other
      • Kits
      • ELISA Kits
      • ELISA Kits
      • Cytokines and cytokine receptors ELISA kits
      • Immunology
      • Immune System Diseases
      • Antiviral Signaling
      • HIV-related

    Associated products

    • Compatible Secondaries

      • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
      • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
    • Isotype control

      • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
    • Recombinant Protein

      • Recombinant human CCL4/MIP-1 beta protein (ab9676)

    Applications

    Our Abpromise guarantee covers the use of ab106548 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    WB 1/500. Predicted molecular weight: 10 kDa.

    Target

    • Function

      Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B.
    • Sequence similarities

      Belongs to the intercrine beta (chemokine CC) family.
    • Post-translational
      modifications

      N-terminal processed form MIP-1-beta(3-69) is produced by proteolytic cleavage after secretion from peripheral blood lymphocytes.
    • Cellular localization

      Secreted.
    • Target information above from: UniProt accession P13236 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 414347 Cow
      • Entrez Gene: 448786 Dog
      • Entrez Gene: 100057859 Horse
      • Entrez Gene: 388372 Human
      • Entrez Gene: 6351 Human
      • Entrez Gene: 9560 Human
      • Entrez Gene: 116637 Rat
      • Omim: 182284 Human
      • Omim: 603782 Human
      • Omim: 610757 Human
      • SwissProt: Q17QA1 Cow
      • SwissProt: Q68AZ0 Dog
      • SwissProt: P13236 Human
      • SwissProt: Q8NHW4 Human
      • SwissProt: P50230 Rat
      • Unigene: 655293 Human
      • Unigene: 661942 Human
      • Unigene: 75703 Human
      • Unigene: 37880 Rat
      see all
    • Alternative names

      • MIP 1 beta antibody
      • Secreted protein G 26 antibody
      • ACT 2 antibody
      • ACT-2 antibody
      • ACT2 antibody
      • AT744.1 antibody
      • AT744.2 antibody
      • C C motif chemokine 4 antibody
      • C C motif chemokine 4 like antibody
      • C C motif chemokine ligand 4 like 1 antibody
      • C C motif chemokine ligand 4 like 2 antibody
      • CC chemokine ligand 4 antibody
      • CC chemokine ligand 4L1 antibody
      • CC chemokine ligand 4L1d2 antibody
      • CC chemokine ligand 4L2 antibody
      • CCL4 antibody
      • CCL4_HUMAN antibody
      • ccl4l 1 antibody
      • CCL4L antibody
      • CCL4L1 antibody
      • Chemokine (C C motif) ligand 4 antibody
      • Chemokine (C C motif) ligand 4 like 1 antibody
      • Chemokine (C C motif) ligand 4 like 1, telomeric antibody
      • Chemokine (C C motif) ligand 4 like 2 antibody
      • Chemokine CC Motif Ligand 4 antibody
      • G 26 antibody
      • G 26 T lymphocyte secreted protein antibody
      • G-26 T-lymphocyte-secreted protein antibody
      • HC21 antibody
      • Immune activation 2 antibody
      • LAG 1 antibody
      • LAG-1 antibody
      • LAG1 antibody
      • Lymphocyte activation gene 1 antibody
      • Lymphocyte activation gene 1 protein antibody
      • Macrophage inflammatory protein 1 beta antibody
      • Macrophage inflammatory protein 1-beta antibody
      • Macrophage inflammatory protein 1b2 antibody
      • MGC104418 antibody
      • MGC126025 antibody
      • MGC126026 antibody
      • MIP-1-beta antibody
      • MIP-1-beta(1-69) antibody
      • MIP-1-beta(3-69) antibody
      • MIP1 beta antibody
      • MIP1B antibody
      • MIP1B1 antibody
      • Monocyte adherence induced protein 5 alpha antibody
      • PAT 744 antibody
      • Protein H400 antibody
      • SCYA2 antibody
      • SCYA4 antibody
      • SCYA4L antibody
      • SCYA4L1 antibody
      • SCYA4L2 antibody
      • SCYQ4L2 antibody
      • Secreted protein G 26 antibody
      • Secreted protein G26 antibody
      • SIS gamma antibody
      • SIS-gamma antibody
      • Small inducible cytokine A4 (homologous to mouse Mip 1b) antibody
      • Small inducible cytokine A4 antibody
      • small inducible cytokine A4-like antibody
      • Small-inducible cytokine A4 antibody
      • T cell activation protein 2 antibody
      • T-cell activation protein 2 antibody
      see all

    Images

    • Western blot - Anti-CCL4/MIP-1 beta antibody (ab106548)
      Western blot - Anti-CCL4/MIP-1 beta antibody (ab106548)
      Anti-CCL4/MIP-1 beta antibody (ab106548) at 4 µg/ml + Recombinant Pig CCL4/MIP-1 beta.

      Secondary
      IRDye800™ Conjugated Goat Anti-Rabbit IgG at 1/20000 dilution

      Predicted band size: 10 kDa

    Protocols

    • Western blot protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
    • SDS
  • References (0)

    Publishing research using ab106548? Please let us know so that we can cite the reference in this datasheet.

    ab106548 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Question

    the enquiry was if you had the reagents to enable a sandwich ELISA for detection of bovine MIP1B.

    In your catalogue you have bovine MIP1B protein (AB87504) and also a cross-reactive rabbit polyclonal MIP-1B antibody that is predicted torecongise bovine MIP1B - do you have a paired antibody (preferably biotinylated) that also potentially cross-reacts with bovine MIP1B?

    Thanks

    Read More

    Abcam community

    Verified customer

    Asked on Feb 08 2012

    Answer

    Thank you for contacting us.

    Regarding your inquiry we currently do not have antibodies that are tested in sELISA with bovine lysates. However on the basis of protein homology between human and bovine it is more likely that the antibody pair ab84260 - ab110604 and ab84439 - ab110604 would work with bovine protein also, in sandwich ELISA method.

    I am sorry, we do not have tested these pairs in species other than human so we are unable to provide any tested data. However I am happy to provide you 2 discount codes if you test one of the pair with Bovine lysates and submit Abreview with tested data. Please click the link to know more about the testing dismount.

    https://www.abcam.com/index.html?pageconfig=resource&rid=11998&viapagetrap=collaborationdiscount

    Let me know by email if you are interested, I will then send you the discount code.

    I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

    Read More

    Abcam Scientific Support

    Answered on Feb 08 2012

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.