Anti-CCL4/MIP-1 beta antibody (ab106548)

Submit a review Q&A (1)

Overview

  • Product name

    Anti-CCL4/MIP-1 beta antibody
    See all CCL4/MIP-1 beta primary antibodies

  • Description

    Rabbit polyclonal to CCL4/MIP-1 beta

  • Host species

    Rabbit

  • Tested applications

    Suitable for: WB, ELISAmore details

  • Species reactivity

    Reacts with: Recombinant fragment
    Predicted to work with: Rat, Rabbit, Horse, Cow, Cat, Dog, Human, Pig, Chimpanzee, Macaque monkey, Opossum

  • Immunogen

    Recombinant full length protein corresponding to Pig CCL4/MIP-1 beta aa 24-92.
    Sequence:

    APMGSDPPTSCCFTYTVRKLPRNFVTDYYETSSLCSQPAVVFQTKKGRQV CANPSDDWVQEYMDDLELN

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • Recombinant Pig CCL4/MIP-1 beta.

  • General notes

     This product was previously labelled as Macrophage Inflammatory Protein 1 beta, MIP1 beta

     

Properties

Applications

Our Abpromise guarantee covers the use of ab106548 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500. Predicted molecular weight: 10 kDa.
ELISA 1/5000.

Target

  • Function

    Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B.

  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.

  • Post-translational
    modifications

    N-terminal processed form MIP-1-beta(3-69) is produced by proteolytic cleavage after secretion from peripheral blood lymphocytes.

  • Cellular localization

    Secreted.
  • Information by UniProt

  • Database links

    see all

  • Alternative names

    • MIP 1 beta antibody
    • Secreted protein G 26 antibody
    • ACT 2 antibody
    • ACT-2 antibody
    • ACT2 antibody
    • AT744.1 antibody
    • AT744.2 antibody
    • C C motif chemokine 4 antibody
    • C C motif chemokine 4 like antibody
    • C C motif chemokine ligand 4 like 1 antibody
    • C C motif chemokine ligand 4 like 2 antibody
    • CC chemokine ligand 4 antibody
    • CC chemokine ligand 4L1 antibody
    • CC chemokine ligand 4L1d2 antibody
    • CC chemokine ligand 4L2 antibody
    • CCL4 antibody
    • CCL4_HUMAN antibody
    • ccl4l 1 antibody
    • CCL4L antibody
    • CCL4L1 antibody
    • Chemokine (C C motif) ligand 4 antibody
    • Chemokine (C C motif) ligand 4 like 1 antibody
    • Chemokine (C C motif) ligand 4 like 1, telomeric antibody
    • Chemokine (C C motif) ligand 4 like 2 antibody
    • Chemokine CC Motif Ligand 4 antibody
    • G 26 antibody
    • G 26 T lymphocyte secreted protein antibody
    • G-26 T-lymphocyte-secreted protein antibody
    • HC21 antibody
    • Immune activation 2 antibody
    • LAG 1 antibody
    • LAG-1 antibody
    • LAG1 antibody
    • Lymphocyte activation gene 1 antibody
    • Lymphocyte activation gene 1 protein antibody
    • Macrophage inflammatory protein 1 beta antibody
    • Macrophage inflammatory protein 1-beta antibody
    • Macrophage inflammatory protein 1b2 antibody
    • MGC104418 antibody
    • MGC126025 antibody
    • MGC126026 antibody
    • MIP-1-beta antibody
    • MIP-1-beta(1-69) antibody
    • MIP-1-beta(3-69) antibody
    • MIP1 beta antibody
    • MIP1B antibody
    • MIP1B1 antibody
    • Monocyte adherence induced protein 5 alpha antibody
    • PAT 744 antibody
    • Protein H400 antibody
    • SCYA2 antibody
    • SCYA4 antibody
    • SCYA4L antibody
    • SCYA4L1 antibody
    • SCYA4L2 antibody
    • SCYQ4L2 antibody
    • Secreted protein G 26 antibody
    • Secreted protein G26 antibody
    • SIS gamma antibody
    • SIS-gamma antibody
    • Small inducible cytokine A4 (homologous to mouse Mip 1b) antibody
    • Small inducible cytokine A4 antibody
    • small inducible cytokine A4-like antibody
    • Small-inducible cytokine A4 antibody
    • T cell activation protein 2 antibody
    • T-cell activation protein 2 antibody
    see all

Images

  • Western blot - Anti-CCL4/MIP-1 beta antibody (ab106548)
    Western blot - Anti-CCL4/MIP-1 beta antibody (ab106548)
    Anti-CCL4/MIP-1 beta antibody (ab106548) at 4 µg/ml + Recombinant Pig CCL4/MIP-1 beta.

    Secondary
    IRDye800™ Conjugated Goat Anti-Rabbit IgG at 1/20000 dilution

    Predicted band size: 10 kDa

References

ab106548 has not yet been referenced specifically in any publications.

Publishing research using ab106548? Please let us know so that we can cite the reference in this datasheet.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

Question

the enquiry was if you had the reagents to enable a sandwich ELISA for detection of bovine MIP1B.

In your catalogue you have bovine MIP1B protein (AB87504) and also a cross-reactive rabbit polyclonal MIP-1B antibody that is predicted torecongise bovine MIP1B - do you have a paired antibody (preferably biotinylated) that also potentially cross-reacts with bovine MIP1B?

Thanks

Read More
Answer

Thank you for contacting us.

Regarding your inquiry we currently do not have antibodies that are tested in sELISA with bovine lysates. However on the basis of protein homology between human and bovine it is more likely that the antibody pair ab84260 - ab110604 and ab84439 - ab110604 would work with bovine protein also, in sandwich ELISA method.

I am sorry, we do not have tested these pairs in species other than human so we are unable to provide any tested data. However I am happy to provide you 2 discount codes if you test one of the pair with Bovine lysates and submit Abreview with tested data. Please click the link to know more about the testing dismount.

https://www.abcam.com/index.html?pageconfig=resource&rid=11998&viapagetrap=collaborationdiscount

Let me know by email if you are interested, I will then send you the discount code.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com