Overview

  • Product name

    Anti-CCM2 antibody [OTI2E4]
    See all CCM2 primary antibodies
  • Description

    Mouse monoclonal [OTI2E4] to CCM2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human CCM2 aa 1-444. Produced in HEK-293T cells (NP_113631).
    Sequence:

    MEEEGKKGKKPGIVSPFKRVFLKGEKSRDKKAHEKVTERRPLHTVVLSLP ERVEPDRLLSDYIEKEVKYLGQLTSIPGYLNPSSRTEILHFIDNAKRAHQ LPGHLTQEHDAVLSLSAYNVKLAWRDGEDIILRVPIHDIAAVSYVRDDAA HLVVLKTAQDPGISPSQSLCAESSRGLSAGSLSESAVGPVEACCLVILAA ESKVAAEELCCLLGQVFQVVYTESTIDFLDRAIFDGASTPTHHLSLHSDD SSTKVDIKETYEVEASTFCFPESVDVGGASPHSKTISESELSASATELLQ DYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCINLRQLYGDSRKFLL LGLRPFIPEKDSQHFENFLETIGVKDGRGIITDSFGRHRRALSTTSSSTT NGNRATGSSDDRSAPSEGDEWDRMISDISSDIEALGCSMDQDSA


    Database link: Q9BSQ5

  • Positive control

    • WB: HEK-293T cells transfected with pCMV6-ENTRY CCM2 cDNA. IHC-P: Human kidney tissue. ICC/IF: COS-7 cells transiently transfected by pCMV6-ENTRY CCM2 cDNA.
  • General notes

    Clone OTI2E4 (formerly 2E4).

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant by affinity chromatography.
  • Clonality

    Monoclonal
  • Clone number

    OTI2E4
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab123930 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 49 kDa.
IHC-P 1/150. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
ICC/IF 1/100.

Target

  • Function

    May function as a scaffold protein for MAP2K3-MAP3K3 signaling. Seems to play a major role in the modulation of MAP3K3-dependent p38 activation induced by hyperosmotic shock.
  • Involvement in disease

    Defects in CCM2 are the cause of cerebral cavernous malformations type 2 (CCM2) [MIM:603284]. Cerebral cavernous malformations (CCMs) are congenital vascular anomalies of the central nervous system that can result in hemorrhagic stroke, seizures, recurrent headaches, and focal neurologic deficits. CCMs have an incidence of 0.1%-0.5% in the general population and are usually present clinically during the 3rd to 5th decades of life. The lesions are characterized by grossly enlarged blood vessels consisting of a single layer of endothelium and without any intervening neural tissue, ranging in diameter from a few millimeters to several centimeters.
  • Sequence similarities

    Contains 1 PID domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • C7orf22 antibody
    • Ccm2 antibody
    • CCM2 gene antibody
    • CCM2_HUMAN antibody
    • Cerebral cavernous malformation 2 antibody
    • Cerebral cavernous malformations 2 protein antibody
    • Chromosome 7 open reading frame 22 antibody
    • Malcavernin antibody
    • MGC4067 antibody
    • MGC4607 antibody
    • MGC74868 antibody
    • OSM antibody
    • Osmosensing scaffold for MEKK3 antibody
    • OTTHUMP00000159554 antibody
    • OTTHUMP00000214270 antibody
    • OTTHUMP00000214271 antibody
    • OTTHUMP00000214273 antibody
    • PP10187 antibody
    see all

Images

  • All lanes : Anti-CCM2 antibody [OTI2E4] (ab123930) at 1/2000 dilution

    Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with pCMV6-ENTRY control cDNA
    Lane 2 : HEK-293T cells transfected with pCMV6-ENTRY CCM2 cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 49 kDa

  • pCMV6-ENTRY CCM2 cDNA transfected COS-7 (African green monkey kidney fibroblast-like cell line) cells stained for CCM2 using ab123930 at a 1/100 dilution in ICC/IF.

  • Paraffin-embedded human kidney tissue stained for CCM2 with ab123930 at a 1/150 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.

References

This product has been referenced in:

  • Costa B  et al. STK25 Protein Mediates TrkA and CCM2 Protein-dependent Death in Pediatric Tumor Cells of Neural Origin. J Biol Chem 287:29285-9 (2012). Read more (PubMed: 22782892) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab123930.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up