Overview

  • Product name

  • Description

    Rabbit polyclonal to CCNDBP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human CCNDBP1 aa 143-230.
    Sequence:

    SPENNDLISYNSVWVACQQMPQIPRDNKAAALLMLTKNVDFVKDAHEEME QAVEECDPYSGLLNDTEENNSDNHNHEDDVLGFPSNQD


    Database link: Q4R809

  • Positive control

    • RT-4 cell lysate; A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220275 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 40 kDa.

Target

  • Function

    May negatively regulate cell cycle progression. May act at least in part via inhibition of the cyclin-D1/CDK4 complex, thereby preventing phosphorylation of RB1 and blocking E2F-dependent transcription.
  • Tissue specificity

    Ubiquitously expressed. Expression is down-regulated in a variety of tumor types including breast, colon, prostate and rectal tumors, and is up-regulated in certain hepatic carcinomas.
  • Sequence similarities

    Belongs to the CCNDBP1 family.
  • Developmental stage

    Expression may increase during differentiation.
  • Post-translational
    modifications

    Phosphorylated.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • AU022347 antibody
    • CCDB1_HUMAN antibody
    • CCNDBP 1 antibody
    • Ccndbp1 antibody
    • Cyclin D type binding protein 1 antibody
    • Cyclin-D1-binding protein 1 antibody
    • D type cyclin interacting protein 1 antibody
    • DIP 1 antibody
    • DIP1 antibody
    • GCIP antibody
    • Grap 2 and cyclin D interacting protein antibody
    • Grap 2 cyclin D interacting protein GCIP antibody
    • Grap 2 cyclin interacting protein antibody
    • Grap2 and cyclin D interacting protein antibody
    • Grap2 and cyclin-D-interacting protein antibody
    • Grap2 cyclin D interacting protein GCIP antibody
    • Grap2 cyclin interacting protein antibody
    • HHM antibody
    • HHM protein antibody
    • Human homolog of Maid antibody
    • MAID antibody
    • MAID protein antibody
    • Maternal inhibition of differentiation antibody
    • MGC109078 antibody
    • OTTMUSP00000017037 antibody
    • RP23 263D22.2 antibody
    • SECC 8 antibody
    • SSEC 8 antibody
    • Stage specific embryonic cDNA 8 antibody
    see all

Images

  • Anti-CCNDBP1 antibody (ab220275) at 1/100 dilution + RT-4 cell lysate

    Predicted band size: 40 kDa

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized A431 cells labeling CCNDBP1 with ab220275 at 4 μg/ml (green).

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220275.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up