Overview

  • Product name

  • Description

    Rabbit polyclonal to CCPG1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human CCPG1 aa 253-376.
    Sequence:

    DELNDMKDYLSQCQQEQESFIDYKSLKENLARCWTLTEAEKMSFETQKTN LATENQYLRVSLEKEEKALSSLQEELNKLREQIRILEDKGTSTELVKENQ KLKQHLEEEKQKKHSFLSQRETLL


    Database link: Q9ULG6

  • Positive control

    • HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab219854 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Acts as an assembly platform for Rho protein signaling complexes. Limits guanine nucleotide exchange activity of MCF2L toward RHOA, which results in an inhibition of both its transcriptional activation ability and its transforming activity. Does not inhibit activity of MCF2L toward CDC42, or activity of MCF2 toward either RHOA or CDC42 (By similarity). May be involved in cell cycle regulation.
  • Sequence similarities

    Belongs to the CCPG1 family.
  • Cellular localization

    Cytoplasmic granule membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CCPG1 antibody
    • CCPG1_HUMAN antibody
    • Cell cycle progression 1 antibody
    • Cell cycle progression protein 1 antibody
    • Cell cycle progression restoration protein 8 antibody
    • CPR8 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized HeLa cells labeling CCPG1 with ab219854 at 4 µg/ml (green).

References

ab219854 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219854.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up