Anti-CCPG1 antibody (ab224748)

Submit a review Submit a question
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CCPG1 antibody (ab224748)

    Key features and details

    • Rabbit polyclonal to CCPG1
    • Suitable for: IHC-P
    • Reacts with: Human
    • Isotype: IgG

    Overview

    • Product name

      Anti-CCPG1 antibody
      See all CCPG1 primary antibodies

    • Description

      Rabbit polyclonal to CCPG1

    • Host species

      Rabbit

    • Tested applications

      Suitable for: IHC-Pmore details

    • Species reactivity

      Reacts with: Human
      Predicted to work with: Orangutan

    • Immunogen

      Recombinant fragment corresponding to Human CCPG1 aa 253-376.
      Sequence:

      DELNDMKDYLSQCQQEQESFIDYKSLKENLARCWTLTEAEKMSFETQKTN LATENQYLRVSLEKEEKALSSLQEELNKLREQIRILEDKGTSTELVKENQ KLKQHLEEEKQKKHSFLSQRETLL


      Database link: Q9ULG6
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

    • Positive control

      • IHC-P: Human duodenum tissue.

    • General notes

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    • Form

      Liquid

    • Storage instructions

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    • Storage buffer

      pH: 7.20
      Preservative: 0.02% Sodium azide
      Constituents: 40% Glycerol (glycerin, glycerine), PBS
    • Concentration information loading...

    • Purity

      Immunogen affinity purified

    • Clonality

      Polyclonal

    • Isotype

      IgG

    Applications

    Our Abpromise guarantee covers the use of ab224748 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

    Target

    • Function

      Acts as an assembly platform for Rho protein signaling complexes. Limits guanine nucleotide exchange activity of MCF2L toward RHOA, which results in an inhibition of both its transcriptional activation ability and its transforming activity. Does not inhibit activity of MCF2L toward CDC42, or activity of MCF2 toward either RHOA or CDC42 (By similarity). May be involved in cell cycle regulation.

    • Sequence similarities

      Belongs to the CCPG1 family.

    • Cellular localization

      Cytoplasmic granule membrane.
    • Information by UniProt

    • Database links

      • Alternative names

        • CCPG1 antibody
        • CCPG1_HUMAN antibody
        • Cell cycle progression 1 antibody
        • Cell cycle progression protein 1 antibody
        • Cell cycle progression restoration protein 8 antibody
        • CPR8 antibody
        see all

      Images

      • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CCPG1 antibody (ab224748)
        Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CCPG1 antibody (ab224748)

        Paraffin-embedded human duodenum tissue stained for CCPG1 using ab224748 at 1/50 dilution in immunohistochemical analysis.

      Protocols

      To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

      Click here to view the general protocols

      References (0)

      Publishing research using ab224748? Please let us know so that we can cite the reference in this datasheet.

      ab224748 has not yet been referenced specifically in any publications.

      Customer reviews and Q&As

      Show All Reviews Q&A
      Submit a review Submit a question

      There are currently no Customer reviews or Questions for ab224748.
      Please use the links above to contact us or submit feedback about this product.

      Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
      For licensing inquiries, please contact partnerships@abcam.com