Overview

  • Product name

    Anti-CCR5 antibody [12D1] - BSA and Azide free
    See all CCR5 primary antibodies
  • Description

    Mouse monoclonal [12D1] to CCR5 - BSA and Azide free
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Frmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Full length native protein (purified) corresponding to Human CCR5 aa 1-352.
    Sequence:

    MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNML VILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTM CQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSV ITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVI LGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAP YNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISV GL


    Database link: P51681

  • Positive control

    • IHC-Fr: Human stomach tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab212302 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-Fr Use a concentration of 0.5 - 1 µg/ml.

(Primary incubation for 30 minutes at RT).

Target

  • Function

    Receptor for a number of inflammatory CC-chemokines including MIP-1-alpha, MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation. Acts as a coreceptor (CD4 being the primary receptor) for HIV-1 R5 isolates.
  • Tissue specificity

    Highly expressed in spleen, thymus, in the myeloid cell line THP-1, in the promyeloblastic cell line KG-1A and on CD4+ and CD8+ T-cells. Medium levels in peripheral blood leukocytes and in small intestine. Low levels in ovary and lung.
  • Involvement in disease

    Genetic variation in CCR5 is associated with suseptibility to diabetes mellitus insulin-dependent type 22 (IDDM22) [MIM:612522]. A multifactorial disorder of glucose homeostasis that is characterized by susceptibility to ketoacidosis in the absence of insulin therapy. Clinical fetaures are polydipsia, polyphagia and polyuria which result from hyperglycemia-induced osmotic diuresis and secondary thirst. These derangements result in long-term complications that affect the eyes, kidneys, nerves, and blood vessels.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Post-translational
    modifications

    Sulfated on at least 2 of the N-terminal tyrosines. Sulfation contributes to the efficiency of HIV-1 entry and is required for efficient binding of the chemokines, CCL3 and CCL4.
    O-glycosylated, but not N-glycosylated. Ser-6 appears to be the major site. Also sialylated glycans present which contribute to chemokine binding. Thr-16 and Ser-17 may also be glycosylated and, if so, with small moieties such as a T-antigen.
    Palmitoylation in the C-terminal is important for cell surface expression, and to a lesser extent, for HIV entry.
    Phosphorylation on serine residues in the C-terminal is stimulated by binding CC chemokines especially by APO-RANTES.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

    see all
  • Alternative names

    • AM4 7 antibody
    • C C chemokine receptor type 5 antibody
    • C C CKR 5 antibody
    • C-C chemokine receptor type 5 antibody
    • C-C CKR-5 antibody
    • C-C motif chemokine receptor 5 A159A antibody
    • CC Chemokine Receptor 5 antibody
    • CC Chemokine Receptor Type 5 antibody
    • CC CKR 5 antibody
    • CC-CKR-5 antibody
    • CCCKR 5 antibody
    • CCCKR5 antibody
    • CCR 5 antibody
    • CCR-5 antibody
    • CCR5 antibody
    • CCR5 chemokine (C C motif) receptor 5 antibody
    • CCR5_HUMAN antibody
    • CD 195 antibody
    • CD195 antibody
    • CD195 Antigen antibody
    • Chemokine C C motif receptor 5 antibody
    • Chemokine receptor CCR5 antibody
    • CHEMR13 antibody
    • CKR 5 antibody
    • CKR5 antibody
    • CMKBR 5 antibody
    • CMKBR5 antibody
    • FLJ78003 antibody
    • HIV 1 Fusion Coreceptor antibody
    • HIV-1 fusion coreceptor antibody
    • HIV1 fusion coreceptor antibody
    • IDDM22 antibody
    • MIP-1 alpha receptor antibody
    see all

Images

  • Frozen human stomach tissue stained for CCR5 using ab212302 at 1 µg/ml in immnohistochemical analysis.

    This IHC-Fr data was generated using the same anti-CCR5 antibody clone, 12D1, in a different buffer formulation.

References

ab212302 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab212302.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up