Overview

  • Product name
  • Description
    Rabbit polyclonal to CCR7
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, Flow Cytmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Mouse CCR7 aa 25-59 (extracellular) conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    QDEVTDDYIGENTTVDYTLYESVCFKKDVRNFKAW


    Database link: P47774

  • Positive control
    • Human colon carcinoma, gastric carcinoma and laryngocarcinoma tissues; Raji cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab217181 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50 – 1/200.

Flow Cyt 1/20 - 1/100.

Target

  • Function
    Receptor for the MIP-3-beta chemokine. Probable mediator of EBV effects on B-lymphocytes or of normal lymphocyte functions.
  • Tissue specificity
    Expressed in various lymphoid tissues and activated B- and T-lymphocytes, strongly up-regulated in B-cells infected with Epstein-Barr virus and T-cells infected with herpesvirus 6 or 7.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • BLR 2 antibody
    • BLR2 antibody
    • C C chemokine receptor type 7 antibody
    • C C CKR 7 antibody
    • C-C chemokine receptor type 7 antibody
    • C-C CKR-7 antibody
    • CC chemokine receptor 7 antibody
    • CC chemokine receptor type 7 antibody
    • CC CKR 7 antibody
    • CC-CKR-7 antibody
    • CCCKR7 antibody
    • CCR 7 antibody
    • CCR-7 antibody
    • Ccr7 antibody
    • CCR7_HUMAN antibody
    • CD 197 antibody
    • CD197 antibody
    • CD197 antigen antibody
    • CDw197 antibody
    • Chemokine (C C motif) receptor 7 antibody
    • Chemokine (C C) receptor 7 antibody
    • Chemokine C C motif receptor 7 antibody
    • Chemokine C C receptor 7 antibody
    • Chemokine receptor 7 antibody
    • Chemokine receptor 7-like protein antibody
    • CMKBR7 antibody
    • EBI 1 antibody
    • EBI1 antibody
    • Ebi1h antibody
    • EBV Induced G Protein Coupled Receptor 1 antibody
    • EBV-induced G-protein coupled receptor 1 antibody
    • Epstein Barr virus induced G protein coupled receptor antibody
    • Epstein Barr virus induced gene 1 antibody
    • Epstein-Barr virus-induced G-protein coupled receptor 1 antibody
    • EVI 1 antibody
    • EVI1 antibody
    • Lymphocyte Specific G Protein Coupled Peptide Receptor antibody
    • MGC108519 antibody
    • MIP 3 beta receptor antibody
    • MIP-3 beta receptor antibody
    • MIP3 Beta Receptor antibody
    see all

Images

  • Flow cytometric analysis of Raji cells labeling CCR7 with ab217181 at 1/100 dilution followed by incubation with a conjugated secondary (PE Conjugated) (green) for 30 minutes compared to control cells (blue), secondary only (light blue) and isotype control (orange).

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded Human gastric carcinoma tissue labeling CCR7 with ab217181 at 1/200 dilution, followed by conjugation to the secondary antibody (Goat Anti-Rabbit IgG, Cy5 conjugated) at 1/200 dilution.

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded Human laryngocarcinoma tissue labeling CCR7 with ab217181 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded Human colon carcinoma tissue labeling CCR7 with ab217181 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab217181 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217181.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up