Overview

  • Product name
  • Description
    Rabbit polyclonal to CCRK
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human CCRK aa 283-345.
    Sequence:

    LLHQYFFTAPLPAHPSELPIPQRLGGPAPKAHPGPPHIHDFHVDRPLEES LLNPELIRPFILE


    Database link: Q8IZL9

  • Positive control
    • IHC-P: Human fallopian tube tissue. WB: U-251 MG, NIH/3T3 and NBT-II cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab252985 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Required for high-level Shh responses in the developing neural tube. Together with BROMI, controls the structure of the primary cilium by coordinating assembly of the ciliary membrane and axoneme, allowing GLI2 to be properly activated in response to SHH signaling (By similarity). Involved in cell growth. Activates CDK2, a kinase involved in the control of the cell cycle, by phosphorylating residue 'Thr-160'.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization
    Nucleus. Cytoplasm. Cell projection > cilium.
  • Information by UniProt
  • Database links
  • Alternative names
    • CAK kinase p42 antibody
    • CAK-kinase p42 antibody
    • CCRK antibody
    • CDCH antibody
    • CDK activating kinase p42 antibody
    • CDK-activating kinase p42 antibody
    • cdk20 antibody
    • CDK20_HUMAN antibody
    • Cell cycle related kinase antibody
    • Cell cycle-related kinase antibody
    • Cell division protein kinase 20 antibody
    • Cyclin dependent protein kinase H antibody
    • Cyclin kinase activating kinase p42 antibody
    • Cyclin-dependent kinase 20 antibody
    • Cyclin-dependent protein kinase H antibody
    • Cyclin-kinase-activating kinase p42 antibody
    • p42 antibody
    • PNQALRE antibody
    see all

Images

  • Paraffin-embedded human fallopian-tube tissue stained for CCRK using ab252985 at 1/50 dilution in immunohistochemical analysis.
  • Paraffin-embedded human skeletal-muscle tissue stained for CCRK using ab252985 at 1/50 dilution in immunohistochemical analysis. Low expression as expected.

  • All lanes : Anti-CCRK antibody (ab252985) at 0.4 µg/ml

    Lane 1 : RT4 (Human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (Human brain glioma cell line) cell lysate
  • All lanes : Anti-CCRK antibody (ab252985) at 0.4 µg/ml

    Lane 1 : NIH/3T3 (Mouse embryo fibroblast cell line) cell lysate
    Lane 2 : NBT-II (Rat cell line) cell lysate

References

ab252985 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab252985.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up