Overview

  • Product name
  • Description
    Rabbit polyclonal to CCT3
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IP, WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Cow, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human CCT3 aa 495-545. The exact sequence is proprietary. (NP_005989.3).
    Sequence:

    IWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQGGAPDAGQ E


    Database link: P49368

  • Positive control
    • HeLa, Jurkat, 293T and Mouse NIH3T3 cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 0.1% BSA, 99% Tris buffered saline
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab176686 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/2000 - 1/10000. Predicted molecular weight: 61 kDa.

Target

Images

  • Detection of Human CCT3 in Immunoprecipitates of HeLa whole cell lysate (1 mg for IP, 20% of IP loaded) using ab176686 at 6 µg/mg lysate for IP and at 0.4 µg/ml for subsequent Western blot detection. Detection: Chemiluminescence with an exposure time of 3 seconds.

  • All lanes : Anti-CCT3 antibody (ab176686) at 0.04 µg/ml

    Lane 1 : HeLa cell lysate at 50 µg
    Lane 2 : HeLa cell lysate at 15 µg
    Lane 3 : 293T cell lysate at 50 µg
    Lane 4 : Jurkat cell lysate at 50 µg
    Lane 5 : Mouse NIH3T3 cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 61 kDa


    Exposure time: 3 seconds

References

ab176686 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176686.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up