Anti-CD10 antibody [MME/1893] - BSA and Azide free (ab237867)

Overview

  • Product name

    Anti-CD10 antibody [MME/1893] - BSA and Azide free
    See all CD10 primary antibodies
  • Description

    Mouse monoclonal [MME/1893] to CD10 - BSA and Azide free
  • Host species

    Mouse
  • Tested applications

    Suitable for: Protein Array, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment within Human CD10 aa 297-483. The exact sequence is proprietary.
    Sequence:

    MLLYNKMTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITNEEDVVV YAPEYLTKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRK ALYGTTSETATWRRCANYVNGNMENAVGRLYVEAAFAGESKHVVEDLIAQ IREVFIQTLDDLTWMDAETKKRAEEKALAIKERIGYP


    Database link: P08473

  • Positive control

    • IHC-P: Human tonsil and kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab237867 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Protein Array Use at an assay dependent concentration.
IHC-P Use a concentration of 1 - 2 µg/ml. Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Incubate with primary antibody for 30 minutes at RT

Target

  • Function

    Thermolysin-like specificity, but is almost confined on acting on polypeptides of up to 30 amino acids. Biologically important in the destruction of opioid peptides such as Met- and Leu-enkephalins by cleavage of a Gly-Phe bond. Able to cleave angiotensin-1, angiotensin-2 and angiotensin 1-9. Involved in the degradation of atrial natriuretic factor (ANF). Displays UV-inducible elastase activity toward skin preelastic and elastic fibers.
  • Sequence similarities

    Belongs to the peptidase M13 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Atriopeptidase antibody
    • CALLA antibody
    • CD10 antibody
    • CD10 antigen antibody
    • Common acute lymphocytic leukemia antigen antibody
    • DKFZp686O16152 antibody
    • EC 3.4.24.11 antibody
    • Enkephalinase antibody
    • EPN antibody
    • Membrane metallo endopeptidase (neutral endopeptidase, enkephalinase) antibody
    • Membrane metallo endopeptidase (neutral endopeptidase, enkephalinase, CALLA, CD10) antibody
    • Membrane metallo endopeptidase antibody
    • Membrane metallo endopeptidase variant 1 antibody
    • Membrane metallo endopeptidase variant 2 antibody
    • Membrane metalloendopeptidase antibody
    • Membrane metalloendopeptidase neutral endopeptidase enkephalinase antibody
    • Membrane metalloendopeptidase neutral endopeptidase enkephalinase CALLA CD10 antibody
    • Membrane metalloendopeptidase variant 1 antibody
    • Membrane metalloendopeptidase variant 2 antibody
    • MGC126681 antibody
    • MGC126707 antibody
    • MME antibody
    • NEP antibody
    • NEP_HUMAN antibody
    • Neprilysin antibody
    • neprilysin-390 antibody
    • neprilysin-411 antibody
    • Neutral endopeptidase 24.11 antibody
    • Neutral endopeptidase antibody
    • Neutral endopeptidase, membrane-associated antibody
    • SFE antibody
    • Skin fibroblast elastase antibody
    see all

Images

  • This data was produced with ab238023, the same antibody in a different formulation with BSA and Azide.
    ab238023 was tested in protein array against over 19000 different full-length human proteins.
    Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProtTM array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProtTM are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target.
    A MAb is specific to its intended target if the MAb has an S-score of at least 2.5. For example, if a MAb binds to protein X with a Z-score of 43 and to protein Y with a Z-score of 14, then the S-score for the binding of that MAb to protein X is equal to 29.
  • Formalin-fixed, paraffin-embedded human kidney tissue stained for CD10 using ab237867 at 2 μg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human tonsil tissue stained for CD10 using ab237867 at 2 μg/ml in immunohistochemical analysis.

References

ab237867 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237867.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up