Anti-CD101 antibody (ab201084)

Submit a review Submit a question

Key features and details

  • Rabbit polyclonal to CD101
  • Suitable for: WB
  • Reacts with: Mouse, Rat, Human
  • Isotype: IgG

Overview

  • Product name

    Anti-CD101 antibody
    See all CD101 primary antibodies

  • Description

    Rabbit polyclonal to CD101

  • Host species

    Rabbit

  • Specificity

    ab201084 detects endogenous levels of CD101.

  • Tested applications

    Suitable for: WBmore details

  • Species reactivity

    Reacts with: Mouse, Rat, Human

  • Immunogen

    Synthetic peptide within Human CD101 aa 767-812. The exact sequence is proprietary.
    Sequence:

    NVEDSDRGKYHCAVEEWLLSTNGTWHKLGEKKSGLTELKLKPTGSK


    Database link: Q93033

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • HEK293T, mouse Raw 264.7 and rat H9C2 cell lysates.

  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid

  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

  • Storage buffer

    pH: 7.30
    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...

  • Purity

    Immunogen affinity purified

  • Purification notes

    ab201084 was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen and the purity is > 95% (by SDS-PAGE).

  • Clonality

    Polyclonal

  • Isotype

    IgG

  • Research areas

Applications

Our Abpromise guarantee covers the use of ab201084 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 115 kDa.

Target

  • Relevance

    CD101 is a disulfide-linked homodimeric type 1 glycoprotein. The peptide is comprised of 7 extracellular V-type IgSF domains. CD101 is highly expressed on monocytes, granulocytes, mucosal T cells, and on activated peripheral blood T cells. Expression is weak on resting T and B and NK cells, absent from platelets and weak or absent from most hematopoietic cell lines. CD101 is thought to play a co-stimulatory role in TCR/CD3-mediated T cell activation. Monoclonal antibodies against CD101 inhibit allogeneic T cell responses. Studies suggest that CD101 plays a major role in the activation of T cells by skin dendritic cells.

  • Cellular localization

    Cell Membrane

  • Database links

    see all

  • Alternative names

    • CD101 molecule antibody
    • cell surface glycoprotein V7 antibody
    • EWI-101 antibody
    • glu-Trp-Ile EWI motif-containing protein 101 antibody
    • IGSF2 antibody
    • Immunoglobulin superfamily member 2 antibody
    • Leukocyte surface protein antibody
    • V7 antibody
    • V7 LSB antibody
    see all

Images

  • Western blot - Anti-CD101 antibody (ab201084)
    Western blot - Anti-CD101 antibody (ab201084)
    All lanes : Anti-CD101 antibody (ab201084)

    Lane 1 : HEK293T whole cell lysate
    Lane 2 : Mouse Raw 264.7 whole cell lysate
    Lane 3 : rat H9C2 whole cell lysate

    Predicted band size: 115 kDa

References (0)

Publishing research using ab201084? Please let us know so that we can cite the reference in this datasheet.

ab201084 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab201084.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com