Anti-CD101 antibody (ab201084)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-CD101 antibody
See all CD101 primary antibodies -
Description
Rabbit polyclonal to CD101 -
Host species
Rabbit -
Specificity
ab201084 detects endogenous levels of CD101. -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Synthetic peptide within Human CD101 aa 767-812. The exact sequence is proprietary.
Sequence:NVEDSDRGKYHCAVEEWLLSTNGTWHKLGEKKSGLTELKLKPTGSK
Database link: Q93033 -
Positive control
- HEK293T, mouse Raw 264.7 and rat H9C2 cell lysates.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.3
Preservative: 0.05% Sodium azide
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab201084 was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen and the purity is > 95% (by SDS-PAGE). -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab201084 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/1000. Predicted molecular weight: 115 kDa. |
Target
-
Relevance
CD101 is a disulfide-linked homodimeric type 1 glycoprotein. The peptide is comprised of 7 extracellular V-type IgSF domains. CD101 is highly expressed on monocytes, granulocytes, mucosal T cells, and on activated peripheral blood T cells. Expression is weak on resting T and B and NK cells, absent from platelets and weak or absent from most hematopoietic cell lines. CD101 is thought to play a co-stimulatory role in TCR/CD3-mediated T cell activation. Monoclonal antibodies against CD101 inhibit allogeneic T cell responses. Studies suggest that CD101 plays a major role in the activation of T cells by skin dendritic cells. -
Cellular localization
Cell Membrane -
Database links
- Entrez Gene: 9398 Human
- Entrez Gene: 630146 Mouse
- Entrez Gene: 310727 Rat
- Omim: 604516 Human
- SwissProt: Q93033 Human
- SwissProt: A8E0Y8 Mouse
- Unigene: 654598 Human
- Unigene: 74115 Human
see all -
Alternative names
- CD101 molecule antibody
- cell surface glycoprotein V7 antibody
- EWI-101 antibody
see all
Images
Protocols
Datasheets and documents
References
ab201084 has not yet been referenced specifically in any publications.