Overview

  • Product name

  • Description

    Rabbit polyclonal to CD101
  • Host species

    Rabbit
  • Specificity

    ab201084 detects endogenous levels of CD101.
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human CD101 aa 767-812. The exact sequence is proprietary.
    Sequence:

    NVEDSDRGKYHCAVEEWLLSTNGTWHKLGEKKSGLTELKLKPTGSK


    Database link: Q93033

  • Positive control

    • HEK293T, mouse Raw 264.7 and rat H9C2 cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab201084 was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen and the purity is > 95% (by SDS-PAGE).
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab201084 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 115 kDa.

Target

  • Relevance

    CD101 is a disulfide-linked homodimeric type 1 glycoprotein. The peptide is comprised of 7 extracellular V-type IgSF domains. CD101 is highly expressed on monocytes, granulocytes, mucosal T cells, and on activated peripheral blood T cells. Expression is weak on resting T and B and NK cells, absent from platelets and weak or absent from most hematopoietic cell lines. CD101 is thought to play a co-stimulatory role in TCR/CD3-mediated T cell activation. Monoclonal antibodies against CD101 inhibit allogeneic T cell responses. Studies suggest that CD101 plays a major role in the activation of T cells by skin dendritic cells.
  • Cellular localization

    Cell Membrane
  • Database links

  • Alternative names

    • CD101 molecule antibody
    • cell surface glycoprotein V7 antibody
    • EWI-101 antibody
    • glu-Trp-Ile EWI motif-containing protein 101 antibody
    • IGSF2 antibody
    • Immunoglobulin superfamily member 2 antibody
    • Leukocyte surface protein antibody
    • V7 antibody
    • V7 LSB antibody
    see all

Images

  • All lanes : Anti-CD101 antibody (ab201084)

    Lane 1 : HEK293T whole cell lysate
    Lane 2 : Mouse Raw 264.7 whole cell lysate
    Lane 3 : rat H9C2 whole cell lysate

    Predicted band size: 115 kDa

References

ab201084 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201084.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up