Overview

  • Product name

    Anti-CD105 antibody [17#]
    See all CD105 primary antibodies
  • Description

    Mouse monoclonal [17#] to CD105
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Rat CD105 aa 26-136. N-terminal His-Tag. Expressed in E. coli.
    Sequence:

    MGHHHHHHSGSEF-ERVGCDLQRVDSTRGEVTYTTSQVSEGCVAQVANAA HEVHVLFLNLSRRKSEVELTLQASKQNGTETREVFLVFISNENVLVKLQA PEIPLHLVYNSSLEVFKGPKVNSTP


    Database link: P17813

  • Positive control

    • WB: Recombinant rat CD105 protein; Human lung tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab239734 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.

Target

  • Function

    Major glycoprotein of vascular endothelium. May play a critical role in the binding of endothelial cells to integrins and/or other RGD receptors.
  • Tissue specificity

    Endoglin is restricted to endothelial cells in all tissues except bone marrow.
  • Involvement in disease

    Defects in ENG are the cause of hereditary hemorrhagic telangiectasia type 1 (HHT1) [MIM:187300, 108010]; also known as Osler-Rendu-Weber syndrome 1 (ORW1). HHT1 is an autosomal dominant multisystemic vascular dysplasia, characterized by recurrent epistaxis, muco-cutaneous telangiectases, gastro-intestinal hemorrhage, and pulmonary (PAVM), cerebral (CAVM) and hepatic arteriovenous malformations; all secondary manifestations of the underlying vascular dysplasia. Although the first symptom of HHT1 in children is generally nose bleed, there is an important clinical heterogeneity.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AI528660 antibody
    • AI662476 antibody
    • CD 105 antibody
    • CD105 antibody
    • CD105 antigen antibody
    • EGLN_HUMAN antibody
    • END antibody
    • Endoglin antibody
    • Eng antibody
    • FLJ41744 antibody
    • HHT1 antibody
    • ORW antibody
    • ORW1 antibody
    • Osler Rendu Weber syndrome 1 antibody
    • RP11 228B15.2 antibody
    • S endoglin antibody
    • S-endoglin antibody
    • SN6 antibody
    see all

Images

  • Anti-CD105 antibody [17#] (ab239734) at 3 µg/ml + Human lung tissue lysate

    Secondary
    HRP-Goat Anti-Mouse IgG at 0.2 µg/ml
  • Anti-CD105 antibody [17#] (ab239734) at 2 µg/ml + Recombinant rat CD105 protein

References

ab239734 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239734.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up