Anti-CD105 antibody (ab231673)
Key features and details
- Rabbit polyclonal to CD105
- Suitable for: IHC-P, WB
- Reacts with: Rat
- Isotype: IgG
Overview
-
Product name
Anti-CD105 antibody
See all CD105 primary antibodies -
Description
Rabbit polyclonal to CD105 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Rat -
Immunogen
Recombinant fragment (His-tag) corresponding to Rat CD105 aa 26-136. Expressed in E.coli.
Sequence:ERVGCDLQRVDSTRGEVTYTTSQVSEGCVAQVANAAHEVHVLFLNLSRRK SEVELTLQASKQNGTETREVFLVFISNENVLVKLQAPEIPLHLVYNSSLE VFKGPKVNSTP
Database link: Q6Q3E8 -
Positive control
- WB: Recombinant rat CD105 protein; rat serum; rat kidney lysate. IHC-P: Rat colon, skeletal muscle, spinal cord, stomach, lung and kidney tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231673 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 5 - 20 µg/ml. | |
WB | Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 70 kDa. |
Target
-
Function
Major glycoprotein of vascular endothelium. May play a critical role in the binding of endothelial cells to integrins and/or other RGD receptors. -
Tissue specificity
Endoglin is restricted to endothelial cells in all tissues except bone marrow. -
Involvement in disease
Defects in ENG are the cause of hereditary hemorrhagic telangiectasia type 1 (HHT1) [MIM:187300, 108010]; also known as Osler-Rendu-Weber syndrome 1 (ORW1). HHT1 is an autosomal dominant multisystemic vascular dysplasia, characterized by recurrent epistaxis, muco-cutaneous telangiectases, gastro-intestinal hemorrhage, and pulmonary (PAVM), cerebral (CAVM) and hepatic arteriovenous malformations; all secondary manifestations of the underlying vascular dysplasia. Although the first symptom of HHT1 in children is generally nose bleed, there is an important clinical heterogeneity. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 497010 Rat
- Unigene: 187025 Rat
-
Alternative names
- AI528660 antibody
- AI662476 antibody
- CD 105 antibody
see all
Images
-
Anti-CD105 antibody (ab231673) at 1 µg/ml + Recombinant rat CD105 protein
Secondary
HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution
Predicted band size: 70 kDa -
All lanes : Anti-CD105 antibody (ab231673) at 1 µg/ml
Lane 1 : Rat serum
Lane 2 : Rat kidney lysate
Secondary
All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution
Predicted band size: 70 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD105 antibody (ab231673)
Formalin-fixed, paraffin-embedded rat colon tissue stained for CD105 using ab231673 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD105 antibody (ab231673)
Formalin-fixed, paraffin-embedded rat skeletal muscle tissue stained for CD105 using ab231673 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD105 antibody (ab231673)
Formalin-fixed, paraffin-embedded rat spinal cord tissue stained for CD105 using ab231673 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD105 antibody (ab231673)
Formalin-fixed, paraffin-embedded rat stomach tissue stained for CD105 using ab231673 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD105 antibody (ab231673)
Formalin-fixed, paraffin-embedded rat lung tissue stained for CD105 using ab231673 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD105 antibody (ab231673)
Formalin-fixed, paraffin-embedded rat kidney tissue stained for CD105 using ab231673 at 20 μg/ml in immunohistochemical analysis. DAB staining.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab231673 has not yet been referenced specifically in any publications.