Anti-CD105 antibody (ab231673)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-CD105 antibody
See all CD105 primary antibodies -
Description
Rabbit polyclonal to CD105 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Rat -
Immunogen
Recombinant fragment (His-tag) corresponding to Rat CD105 aa 26-136. Expressed in E.coli.
Sequence:ERVGCDLQRVDSTRGEVTYTTSQVSEGCVAQVANAAHEVHVLFLNLSRRK SEVELTLQASKQNGTETREVFLVFISNENVLVKLQAPEIPLHLVYNSSLE VFKGPKVNSTP
Database link: Q6Q3E8 -
Positive control
- WB: Recombinant rat CD105 protein; rat serum; rat kidney lysate. IHC-P: Rat colon, skeletal muscle, spinal cord, stomach, lung and kidney tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231673 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | Use a concentration of 5 - 20 µg/ml. | |
| WB | Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 70 kDa. |
Target
-
Function
Major glycoprotein of vascular endothelium. May play a critical role in the binding of endothelial cells to integrins and/or other RGD receptors. -
Tissue specificity
Endoglin is restricted to endothelial cells in all tissues except bone marrow. -
Involvement in disease
Defects in ENG are the cause of hereditary hemorrhagic telangiectasia type 1 (HHT1) [MIM:187300, 108010]; also known as Osler-Rendu-Weber syndrome 1 (ORW1). HHT1 is an autosomal dominant multisystemic vascular dysplasia, characterized by recurrent epistaxis, muco-cutaneous telangiectases, gastro-intestinal hemorrhage, and pulmonary (PAVM), cerebral (CAVM) and hepatic arteriovenous malformations; all secondary manifestations of the underlying vascular dysplasia. Although the first symptom of HHT1 in children is generally nose bleed, there is an important clinical heterogeneity. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 497010 Rat
- Unigene: 187025 Rat
-
Alternative names
- AI528660 antibody
- AI662476 antibody
- CD 105 antibody
see all
Images
-
Western blot - Anti-CD105 antibody (ab231673)Anti-CD105 antibody (ab231673) at 1 µg/ml + Recombinant rat CD105 protein
Secondary
HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution
Predicted band size: 70 kDa -
Western blot - Anti-CD105 antibody (ab231673)All lanes : Anti-CD105 antibody (ab231673) at 1 µg/ml
Lane 1 : Rat serum
Lane 2 : Rat kidney lysate
Secondary
All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution
Predicted band size: 70 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD105 antibody (ab231673)Formalin-fixed, paraffin-embedded rat colon tissue stained for CD105 using ab231673 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD105 antibody (ab231673)Formalin-fixed, paraffin-embedded rat skeletal muscle tissue stained for CD105 using ab231673 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD105 antibody (ab231673)Formalin-fixed, paraffin-embedded rat spinal cord tissue stained for CD105 using ab231673 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD105 antibody (ab231673)Formalin-fixed, paraffin-embedded rat stomach tissue stained for CD105 using ab231673 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD105 antibody (ab231673)Formalin-fixed, paraffin-embedded rat lung tissue stained for CD105 using ab231673 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD105 antibody (ab231673)Formalin-fixed, paraffin-embedded rat kidney tissue stained for CD105 using ab231673 at 20 μg/ml in immunohistochemical analysis. DAB staining.
Datasheets and documents
References
ab231673 has not yet been referenced specifically in any publications.
