Overview

  • Product name

    Anti-CD11c antibody [ITGAX/1242]
    See all CD11c primary antibodies
  • Description

    Mouse monoclonal [ITGAX/1242] to CD11c
  • Host species

    Mouse
  • Tested applications

    Suitable for: Protein Array, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment within Human CD11c aa 601-850. The exact sequence is proprietary.
    Sequence:

    DLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLV QSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSL SRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLR PMLAADAQRYFTASLPFEKNCGADHICQDNLGISFSFPGLKSLLVGSNLE LNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQLRSLHLTCDS


    Database link: P20702

  • Positive control

    • Human tonsil tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab216028 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Protein Array Use at an assay dependent concentration.
IHC-P Use a concentration of 1 - 2 µg/ml. Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Target

  • Function

    Integrin alpha-X/beta-2 is a receptor for fibrinogen. It recognizes the sequence G-P-R in fibrinogen. It mediates cell-cell interaction during inflammatory responses. It is especially important in monocyte adhesion and chemotaxis.
  • Tissue specificity

    Predominantly expressed in monocytes and granulocytes.
  • Sequence similarities

    Belongs to the integrin alpha chain family.
    Contains 7 FG-GAP repeats.
    Contains 1 VWFA domain.
  • Domain

    The integrin I-domain (insert) is a VWFA domain. Integrins with I-domains do not undergo protease cleavage.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 95 alpha chain antibody
    • 95 antibody
    • CD 11c antibody
    • CD11 antigen like family member C antibody
    • CD11 antigen-like family member C antibody
    • CD11c antibody
    • CD11c antigen antibody
    • Complement component 3 receptor 4 subunit antibody
    • CR4 antibody
    • Integrin alpha X antibody
    • Integrin alpha X chain antibody
    • Integrin alpha-X antibody
    • Integrin aX antibody
    • Integrin subunit alpha X antibody
    • integrin, alpha X (antigen CD11C (p150), alpha polypeptide) antibody
    • integrin, alpha X (complement component 3 receptor 4 subunit antibody
    • ITAX_HUMAN antibody
    • ITGAX antibody
    • LEU M5 alpha subunit antibody
    • Leu M5 antibody
    • Leukocyte adhesion glycoprotein p150 95 alpha chain antibody
    • Leukocyte adhesion glycoprotein p150 antibody
    • Leukocyte adhesion receptor p150 95 antibody
    • Leukocyte adhesion receptor p150 antibody
    • Leukocyte surface antigen p150 95 alpha subunit antibody
    • Leukocyte surface antigen p150 alpha subunit antibody
    • Myeloid membrane antigen alpha subunit antibody
    • p150 95 integrin alpha chain antibody
    • p150 antibody
    • p150/95 antibody
    • SLEB6 antibody
    see all

Images

  • ab216028 was tested in protein array against over 19000 different full-length human proteins.
    Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProtTM array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProtTM are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target.
    A MAb is specific to its intended target if the MAb has an S-score of at least 2.5. For example, if a MAb binds to protein X with a Z-score of 43 and to protein Y with a Z-score of 14, then the S-score for the binding of that MAb to protein X is equal to 29.
  • Immunohistochemical analysis of formalin fixed, paraffin embedded Human tonsil tissue labeling CD11c with ab216028 at 1 µg/mL, followed by ABC detection with DAB Chromogen.

References

ab216028 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216028.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up