Overview

  • Product name

  • Description

    Rabbit polyclonal to CD11d
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse CD11d aa 886-1106. Expressed in E.coli.
    Sequence:

    FDVSYKAFLGDRLLLRASASSENNKPETSKTAFQLELPVKYTVYTVISRQ EDSTKHFNFSSSHGERQKEAEHRYRVNNLSPLTLAISVNFWVPILLNGVA VWDVTLRSPAQGVSCVSQREPPQHSDLLTQIQGRSVLDCAIADCLHLRCD IPSLGTLDELDFILKGNLSFGWISQTLQKKVLLLSEAEITFNTSVYSQLP GQEAFLRAQVSTMLEEYVVYE


    Database link: Q3V0T4

  • Positive control

    • IHC-P: Mouse kidney tissue. WB: Recombinant mouse CD11d protein; HEK-293T whole cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231534 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 128 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Relevance

    The ad integrin is a newly recognised integrin chain that is expressed as a heterodimer with the b2 integrin (CD18). ad is expressed by a sub-population of CD8 positive T cells, macrophages and by gd T cells in the splenic red pulp.
  • Cellular localization

    Plasma membrane
  • Database links

  • Alternative names

    • ADB2 antibody
    • FLJ39841 antibody
    • integrin alpha D antibody

Images

  • Anti-CD11d antibody (ab231534) at 2 µg/ml + HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate.

    Predicted band size: 128 kDa

  • Anti-CD11d antibody (ab231534) at 2 µg/ml + Recombinant mouse CD11d protein.

    Predicted band size: 128 kDa

  • Formalin-fixed, paraffin-embedded mouse kidney tissue stained for CD11d using ab231534 at 20 µg/ml in immunohistochemical analysis.

References

ab231534 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231534.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up