Overview

  • Product name

  • Description

    Rabbit polyclonal to CD11d
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human CD11d aa 879-1099. (Expressed in E.coli)
    Sequence:

    FDVSYKATLGDRMLMRASASSENNKASSSKATFQLELPVKYAVYTMISRQ EESTKYFNFATSDEKKMKEAEHRYRVNNLSQRDLAISINFWVPVLLNGVA VWDVVMEAPSQSLPCVSERKPPQHSDFLTQISRSPMLDCSIADCLQFRCD VPSFSVQEELDFTLKGNLSFGWVRETLQKKVLVVSVAEITFDTSVYSQLP GQEAFMRAQMEMVLEEDEVYN


    Database link: Q13349

  • Positive control

    • WB: Human serum; Recombinant human CD11d protein. IHC-P: Human liver, breast cancer, kidney and rectum tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231622 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml.

Target

  • Relevance

    The ad integrin is a newly recognised integrin chain that is expressed as a heterodimer with the b2 integrin (CD18). ad is expressed by a sub-population of CD8 positive T cells, macrophages and by gd T cells in the splenic red pulp.
  • Cellular localization

    Plasma membrane
  • Database links

  • Alternative names

    • ADB2 antibody
    • FLJ39841 antibody
    • integrin alpha D antibody

Images

  • Formalin-fixed, paraffin-embedded human rectum tissue stained for CD11d using ab231622 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for CD11d using ab231622 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for CD11d using ab231622 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for CD11d using ab231622 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-CD11d antibody (ab231622) at 2 µg/ml + Human serum

    Secondary
    HRP-linked Guinea pig Anti-Rabbit at 1/2000 dilution
  • Anti-CD11d antibody (ab231622) at 2 µg/ml + Recombinant human CD11d protein

References

ab231622 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231622.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up